KEGG   Nostoc punctiforme: Npun_F5459Help
Entry
Npun_F5459        CDS       T00713                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
npu  Nostoc punctiforme
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Npun_F5459
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_F5459
   00680 Methane metabolism
    Npun_F5459
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Npun_F5459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
6741841..6744954
Genome map
AA seq 1037 aa AA seqDB search
MGSLLYSSSQTADIYPVSELFLRHRLQVVEELWESVLRQECGQNMVDLLRQLRDLCSPEG
QATNDQASSAVKLIEQLNINEAIRAARAFALYFQLINIIEQEYEQRQQLSRYEAETEPTD
SERASNVNYSSNQREDDAPVSKGIAAELLAKNYLEKAQVKPKGTFAALFPYLFKQNVPPQ
QIQRLIAHLDVRLVFTAHPTEIVRHTIRDKQRQVVQLLQKLDTLENHAGGTGGGYAWEAA
DVREQLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRFKHTLSNTF
PWLEPPSKNFCSFGSWVGSDRDGNPSVTPEVTWQTACYQRKMVLGRYIQSVKNLIELLSV
SMHWSDVLPDLLESLELDQSQLSEVYDALALRYRQEPYRLKLAYVLKRLENTRDRNLALY
NRETPKNQDSPLYRSGDDFLAELRMIQRNLTETGLSCRDLENLICQVEIFGFNLTQLDIR
QESSRHADALNEILQYLQILPQPYNELSEEQKVAWLTGELQTRRPLIPAELPFSEKTNDV
IETFRVVRSLQQEFGLNICQTYIISMCRDVSDVLEVLLLAKEARLFDPAIAVGTIQVVPL
FETVEDLQRSRSVMRKLFELPLYRALLAGGYEQTKTESVVVDENSSSLASPAPPASPASP
APSPSPLTPNLQEVMLGYSDSNKDSGFLSSNWEIHKAQKSLQQIAEGYDINLRIFHGRGG
SVGRGGGPAYEAILAQPGHSINGRIKITEQGEVLASKYSLLDLALYHMETITTAVIQASL
LRTGFDDIEPWNEIMEELAARSRQHYRALIYEQPDFVDFFHQVTPIEEISQLQISSRPAR
RPSGKKDLSSLRAIPWVFSWTQTRFLLPSWYGVGTALQEFLNAEPEEHLKLMRYFYVKWP
FFKMVISKAEMTLAKVDMQMAHHYVQELSQSEDQLRFAKVFDQIASEFYLTRDLVLKITD
HNQLLDGDPVLQRSVQLRNGTIVPLGFIQVSLLKRLRQSMNTNATSGVIHSRYSKGELLR
GALLTINGIAAGMRNTG
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccttttatactcttcgtctcaaactgcggatatatacccggtgtcggaatta
tttttgcgtcatcgtctccaggtagtggaagaattgtgggagtctgttctccggcaagaa
tgcggtcaaaacatggtagacttgttgcggcagctgcgcgatctgtgttcgccagaagga
caggcaacaaatgaccaagcatcctcagccgtcaaattaattgaacaactaaatatcaac
gaagcaatccgcgcggctcgtgctttcgctctgtattttcagctgattaacatcatagag
caggaatacgagcaaaggcagcaactgagtcgctatgaagcagaaacagagcctacagac
tcagaaagagcatctaatgtcaattactcgtccaatcaaagagaagatgatgcgcctgtt
agcaagggaatagcagcagaattgctagcaaagaactatctagaaaaagcgcaagtcaaa
ccaaaagggactttcgctgccttgtttccctatttattcaaacagaatgtaccaccccag
cagattcaacgtctcattgctcatctagatgtgcgcttagttttcacagcgcacccgacg
gaaattgttcgtcataccatccgagataagcagcgacaggtggtacaactcttgcaaaaa
ctggataccttagaaaaccatgctggtggtacaggtggcggatatgcttgggaagcagca
gatgtccgcgaacaattgcttgaagaaattcgcctctggtggcgcacggacgaacttcac
cagttcaaacctactgtgctagatgaagtagattatgccctccactacttccaagaagtt
ttatttgatggcattcctcaactttataaacgtttcaaacatacactatctaataccttt
ccttggctagaaccaccaagtaaaaacttttgttcttttggctcttgggtaggctcagat
agggatgggaacccatcagttacaccagaagtgacctggcaaacagcttgctatcagcgc
aaaatggtcctggggagatatattcagtcagtgaaaaatctgattgaattgttgagtgtg
tcgatgcactggagtgatgtcttaccagatttgctggaatctctagagttagatcagtcc
cagttgagtgaggtatatgatgcactggcgctgcgttatcggcaagaaccctatcggctg
aaactcgcttatgtactgaaacgactagaaaatactcgcgatcgcaatctagctttgtac
aatcgggaaacgccaaaaaatcaagatagtcccctgtatcgttcgggagacgatttttta
gctgaactgcggatgattcagcgtaacttgacagaaacaggtttaagctgtcgagattta
gaaaatctcatctgtcaggtagaaatttttggttttaacttgacacagctagatatccgt
caagaatcatcccgccatgctgatgcgctaaatgaaatcctacaatacctgcaaatatta
cctcaaccttacaacgaactatctgaggagcaaaaagttgcttggcttacaggagaactg
caaacccgccggccattaattccagcagaattgccattttctgaaaaaaccaacgatgta
attgaaacctttcgcgtcgtgcgatcgctgcaacaagaatttggtctaaatatctgccaa
acttacattatcagcatgtgccgcgacgtgagcgacgtgctagaagtactactgttagcc
aaagaagccagactttttgaccccgccatagccgtgggaaccattcaagttgtcccctta
tttgaaacagtagaagacttacaacgctccagaagcgtcatgcggaaactgtttgaactc
ccgttatatcgcgctttgttagccggtggctacgaacaaacaaaaacagagagtgttgtc
gtggatgaaaattcatcctcccttgcctcccctgccccccctgcttcccccgcttcccct
gccccctccccctcccccctcacccctaacttgcaagaagtgatgctggggtattctgac
agcaacaaagactctggttttttaagcagcaactgggaaattcataaagcccaaaaatca
ctgcaacaaatagcagaaggctacgatataaatttgcggattttccacggacgcggcggt
tctgtagggcggggtggtggccctgcttacgaggcaattttggctcaaccgggtcatagt
atcaatgggcgaatcaagattaccgaacaaggagaagttttggcttctaaatactccttg
ttggacttggctttgtaccacatggaaaccatcaccactgctgtgattcaagctagcctg
ctgcggacagggtttgatgatattgaaccctggaatgagattatggaagaattagcagcg
cgatcgcggcaacattatcgggctttaatttatgaacagcctgattttgtggactttttc
catcaagtaacccccattgaagaaattagccagctacaaattagttcccgtccagcccgt
cgcccatctggtaagaaagatttaagcagtctgcgagctattccttgggtatttagttgg
acgcaaacccgctttttgcttccttcctggtatggcgttggcacagcgttacaagaattc
ttgaatgcagaaccagaagaacacttgaaattaatgcgctacttttacgttaagtggccc
tttttcaagatggtgatttctaaggccgagatgactttggcaaaagtagatatgcaaatg
gcacatcactacgttcaagaattgtcacaatcagaagatcaactccgctttgctaaggtt
tttgaccaaattgccagcgagttctatctcacaagggatttggtgttaaaaatcaccgat
cacaatcaattgttagatggcgatcctgtcttgcaacgatctgtgcagttacgcaatggc
acaattgtccccttgggatttatccaagtttccctgctcaagcgcctacgccagtctatg
aatactaatgccacttctggagtcatccattctcgttacagcaaaggcgagttactacga
ggtgcattgttaactattaatggaattgcagccgggatgagaaatacaggttga

DBGET integrated database retrieval system