KEGG   Nostoc punctiforme: Npun_F5633Help
Entry
Npun_F5633        CDS       T00713                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
npu  Nostoc punctiforme
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Npun_F5633
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Npun_F5633
Enzymes [BR:npu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Npun_F5633
Peptidoglycan biosynthesis and degradation proteins [BR:npu01011]
 Precursor biosynthesis
  Racemase
   Npun_F5633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
6948457..6949644
Genome map
AA seq 395 aa AA seqDB search
MLSRKEIPGVVPNQQCDTYAWFSQRAWVEIDLGALSYNVQQLVQFLSPRTQLMAVVKADA
YGHGALTVAQTVIQSGASWLGVATVPEAIQLREGGIEAPILILGATHTPEQIHAIAQWNL
QPTLCSPKQALVFSNILESMNHGSPVPVHIKLDTGMSRLGTNWQQAGEFVQLVQRLPHLS
IASIYSHLATADDPDTTAMEEQHRRFEEAIAQIKAMEIEAPCLHLANSAAALTDPALHYD
IVRVGLAVYGLYPAPHLQNAIDLKPVLQLKARVTQVKTIAAGTAVSYGHKFIAPRELRLA
VVGIGYADGVPRSLSNKMQALIHGQRVSQIGTITMDQLMLDVSAIPNIQEGEVVTLLGKQ
GKEQISADDWAEQLNTISWEILCGFKHRLPRVAVM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtcgcaaagaaatccctggtgtagttcctaatcagcagtgcgacacctacgcg
tggttttcgcaacgagcttgggtagaaattgatttgggggcgttgtcgtacaatgtacag
caattggtgcagtttttatcgccgcgtacccagttgatggcagtagtaaaagctgatgct
tatggacatggagcgctaacagtcgcccaaactgtaattcaatcaggagctagttggctg
ggagtcgctacagttccagaagctattcaattgcgagaaggcgggattgaagcgcccatt
ttgattttaggagcaactcatacaccagaacagattcatgcgatcgcacaatggaatctt
cagcccacactctgtagccctaaacaagctttggtattttctaatatcctggaatccatg
aatcatggttcgccagtgcccgtacacatcaaattagacacgggtatgtctaggttagga
actaattggcagcaagctggtgaatttgtgcaattagtgcagcgcttaccacatctatcc
attgccagtatttattctcatttggcaacagcagacgatcctgatacaacggcaatggaa
gaacagcatagacgatttgaggaagcgatcgctcaaatcaaagcaatggaaattgaagcg
ccttgcttgcacttggcaaactcagcagctgcactcacagatccggcattgcattacgat
attgtacgtgtaggtttagccgtttacggactttacccagcaccgcatttacaaaatgcg
atcgatctcaagcccgttttgcaacttaaagcacgagtcacccaagttaaaacaattgcg
gcaggaactgctgttagctacgggcataaatttattgccccgcgtgaacttcgcctcgct
gttgtcggaattggttatgctgatggcgttcctcgtagtctttctaacaaaatgcaggcg
ttaattcacggtcagagagtgtcgcaaatcggcacaattacaatggatcagttgatgctg
gatgtaagtgccatacccaatatccaagaaggagaagtagtcaccttactaggaaagcag
ggaaaagaacaaatttccgcagacgattgggcagaacaactaaacactatttcttgggaa
attctctgcgggttcaagcatcgtctgcctcgtgttgcagtcatgtaa

DBGET integrated database retrieval system