KEGG   Neurospora tetrasperma: NEUTE1DRAFT53729Help
Entry
NEUTE1DRAFT53729  CDS       T03451                                 

Gene name
NEUTE1DRAFT_53729
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
nte  Neurospora tetrasperma
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nte00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NEUTE1DRAFT53729 (NEUTE1DRAFT_53729)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NEUTE1DRAFT53729 (NEUTE1DRAFT_53729)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEUTE1DRAFT53729 (NEUTE1DRAFT_53729)
   00430 Taurine and hypotaurine metabolism
    NEUTE1DRAFT53729 (NEUTE1DRAFT_53729)
Enzymes [BR:nte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NEUTE1DRAFT53729 (NEUTE1DRAFT_53729)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 565 aa AA seqDB search
VDPEEIIHHLKDIRLQEKGSGSQRQNHLTPYNSSYASQEDIPKYKIPENGTPGDTVYAML
RDELDLDGRPNLNMASFVNTYIEKDAQKLFVENLGKNLSDNDEYPAMISFSDRCVSILAH
LWGVQKGEKAIGTATVGSSEAVHLGGLAMKRRWQEKRRAEGKDAYKPNIIMGANAQVALE
KFARYFDVEARILPVSAKSNYCLDPALVKENLDENTIGVFVILGSTYTGHYEPVEEIHKI
LDDFESQTGIDIPIHVDAASGGFVAPFTYAKTGGQKWNFELPRVKSINVSGHKYGLVTPG
VGWIVWRDESFLPKHLIFELHYLGGTEYSYTLNFSRPGAQVIVQYYNLIHLGFQGYRAVV
ENCLSNARLLSKALEATGWYTCVSDIHRPPQKQAGSTHASSSSSLSSKDTPADENREEET
SADYTPGLPVVSFRFTDEFQQEYPHVKQETVSLLMRARQWIIPNYALPPNEDQTEILRVV
IRESFSFDLIDRLVTDLVRVTETLMENDEVDLSLLQQHQGGRRRPVTKDDKRTQKEERER
EERKGEERGEEKGKRMGEGIHRSVC
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gttgatcccgaggagatcatccatcacctcaaggacatcaggctccaagaaaagggcagt
ggaagccagaggcagaatcaccttacaccctacaacagctcctacgccagccaagaagac
atccccaagtacaagattcccgagaatggcactccaggagacaccgtctacgccatgctc
agggacgagctggacctagacggcaggccaaatctcaacatggccagcttcgtcaacact
tatattgagaaagacgcccagaagctctttgtcgagaacctaggcaagaacctctccgac
aatgacgaatatcccgccatgatctccttcagcgaccgctgcgtcagcatcctcgctcat
ctctggggtgtccaaaagggcgaaaaagccattggcaccgccaccgtcggctcctcggaa
gccgttcacctcggcggcttagccatgaagcgtcgatggcaggagaagcgccgggccgag
ggcaaagacgcctacaagcccaacatcatcatgggcgccaacgcgcaagtcgctctggaa
aagttcgcccgctacttcgacgtcgaggcccgtatcctgcccgtctcggccaagagtaac
tactgcctggacccagctttggtaaaggagaacctagacgagaacaccatcggcgtcttt
gtcatcctcggcagcacttacacaggccactacgagcccgtcgaagaaatccacaagatc
ctcgatgactttgaatcgcaaacgggcatcgacatccccatccacgtcgatgccgccagc
ggggggttcgtcgccccctttacctacgccaagacaggcggacagaaatggaactttgag
cttccccgcgtcaagtccatcaacgtctcgggtcacaagtacggcctggtcacgcccggt
gtagggtggatcgtgtggagggacgagtcctttttgcccaagcatttgattttcgagctg
cactacttggggggaaccgagtacagctacacgctcaacttctcgcgccccggtgcgcag
gtcattgtgcagtattacaatctcatccacctcgggtttcaggggtatcgcgccgtggtg
gagaactgtctctccaatgcgcgcttgttgtccaaagcgctggaggcgacagggtggtat
acctgcgttagcgatattcatcggccgccgcagaagcaagcaggttctacccatgcctct
tcttcttcttcgttgtcgtcaaaagacacccccgcggacgaaaaccgcgaagaagaaacc
tccgccgactacacccccggcctccccgtcgtctcgttccgcttcaccgacgagttccag
caggagtacccgcacgtaaagcaagaaaccgtgtcccttttgatgcgcgcccggcagtgg
atcattcccaactacgctctgccgcccaacgaggaccagacggagattttgagggtggtg
attcgcgagtcgttttcgtttgatctgatcgatagacttgttacggacttggtgagggtt
acggagacgctgatggagaacgatgaggttgatttgagcttgttgcagcagcatcagggg
ggacggaggaggccagttacgaaggacgataagagaacacagaaggaggagagggagagg
gaggagagaaagggggaggaaaggggggaggagaaggggaagaggatgggagagggaatt
catagaagtgtttgttaa

DBGET integrated database retrieval system