KEGG   Natranaerobius thermophilus: Nther_0307Help
Entry
Nther_0307        CDS       T00761                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
nth  Natranaerobius thermophilus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nther_0307
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Nther_0307
Enzymes [BR:nth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Nther_0307
Peptidoglycan biosynthesis and degradation proteins [BR:nth01011]
 Precursor biosynthesis
  Racemase
   Nther_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
324660..325832
Genome map
AA seq 390 aa AA seqDB search
MSESIPVRPTFSEINLDNLSYNFNRIREHVNNKKIMGIIKADGYGHGAVEIAEELLNQGV
DYLGVAILDEAVELRKAGIAAPILILGYTPVEHVDVCLKYGITPTIYTYEMAEALSQTAR
KMGKTAFVHVKIDTGMGRIGIAPENSAEFVKNISKLPSLEVEGVFTHFSVADEEDKTYTQ
QQINSFEKALKMLEDEGIEIPLKHAANSPATIDLPDAYFDMVRVGLALFGLYPSPHMKEK
ISLKPVMSLKTQVSHVKQVPKGTSISYGRKFITEDESIIGTLPVGYADGFTRLLSNIGEV
IVNGKRVPIVGAICMDQCMFLGDDVPEIGIGDEVVIIGEQDGTQITVEDIADKLGTINYE
IVTMVDKRVPRLYLKNGKLIKKKSLNSKMY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatctattcctgtaagaccgactttttctgaaattaacttggacaatctttct
tataactttaatcggataagagagcatgtgaacaataaaaaaatcatgggtatcattaaa
gctgatggttatggtcatggagctgttgaaattgccgaagaactattgaatcaaggtgta
gattatttaggtgtagctattttagacgaagctgtggaactaaggaaagcaggaatcgct
gctcctattttaattcttggctatacacctgtagagcatgttgatgtatgtttgaaatat
ggtatcactcccacaatttatacctatgaaatggcagaagccctttctcaaaccgctaga
aaaatggggaaaactgcctttgttcacgtaaaaattgatacaggcatgggtcggatagga
atagctccagaaaatagtgctgagtttgtcaaaaatattagcaaattgccatccttagaa
gtggaaggtgttttcacgcatttttcagtagcagatgaggaagataagacttatacacaa
cagcaaatcaatagctttgaaaaagccttaaagatgttagaagatgaaggtattgaaatt
cctctaaaacatgctgctaacagtcctgctactattgacttgccagatgcatattttgat
atggttagggttggactagccttattcggtttatatccttctccgcacatgaaggaaaaa
atttcactaaaaccagtaatgagtcttaaaactcaagtatcccatgtgaaacaagttccc
aagggaacttctataagttatggtaggaagtttattactgaagatgaaagtattattggc
acattaccagttggttatgcagatggctttacacgattactatctaatataggtgaagtc
atagttaatggtaaaagagtgcccattgtaggagccatatgtatggaccaatgcatgttc
ctaggtgacgatgtaccggagattggaatcggagatgaagtagttattattggtgaacaa
gatggtactcaaattacagttgaggatatagctgataaactaggaactatcaactatgaa
atagttactatggtggacaaacgagtgccacgtttatatctaaaaaatggcaaattaatc
aaaaagaaatctttaaatagcaaaatgtattag

DBGET integrated database retrieval system