KEGG   Natranaerobius thermophilus: Nther_2004Help
Entry
Nther_2004        CDS       T00761                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00010  Glycolysis / Gluconeogenesis
nth00030  Pentose phosphate pathway
nth00051  Fructose and mannose metabolism
nth00052  Galactose metabolism
nth00680  Methane metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01120  Microbial metabolism in diverse environments
nth01130  Biosynthesis of antibiotics
nth01200  Carbon metabolism
nth01230  Biosynthesis of amino acids
nth03018  RNA degradation
Module
nth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nther_2004
   00030 Pentose phosphate pathway
    Nther_2004
   00051 Fructose and mannose metabolism
    Nther_2004
   00052 Galactose metabolism
    Nther_2004
  Energy metabolism
   00680 Methane metabolism
    Nther_2004
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Nther_2004
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nther_2004
Protein phosphatases and associated proteins [BR:nth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Nther_2004
Messenger RNA biogenesis [BR:nth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Nther_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACB85571
JGI: Nther2004
UniProt: B2A6Y0
LinkDB All DBs
Position
complement(2112388..2113347)
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDSPGMNATIRAVVRRGIYMGLDIYGIYYGFSGLINGNIEKLEIGSVGDI
IHRGGTILHTSRSEEFKTEMGQQKGFDNLKELGIEGLIVIGGDGSFKGAEKLSQMGLPVI
GVPGTIDNDIPETEMSIGFDTALNTVIEAIDRIRDTATSHERIFVIEVMGRDCGNLALWS
GLAGGAESVLIPEIDYDMEKVIERLKHGYKRGKKHSIIIVAEGVKPGAEIGKEIKERAGL
DNRVTVLGHVQRGGTPTAYDRMLGSRLGAKAVDLLVAGESDKMIGMRDYKLVPVQFKDVF
SKIEEPDYDIYELSQSLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggagttttaaccagtggaggagattctcctggcatgaatgccactatt
agagcagtggtgcgccggggcatatatatgggtttagatatttatgggatatattatggc
tttagtggattgataaatggaaatatcgaaaaattagaaataggtagtgtgggagatatc
atccaccgcggtggtaccattttgcacaccagtaggtctgaagagtttaaaaccgaaatg
ggacaacaaaaaggttttgataatttaaaagaactgggaattgaagggttaattgttatc
ggaggggatggaagtttcaagggagcagagaaattatctcaaatggggttaccagtaata
ggtgttccaggaactatcgataatgatattcctgaaacagagatgagtattggctttgat
acagccctcaacactgtcattgaagctatcgaccgcataagagatactgccacttcccat
gaacgaatatttgtaatagaagttatgggaagagattgtggtaatttagctttatggtca
ggtttagccggtggggccgaatctgtactgattccagaaatagattacgatatggaaaag
gttatcgaaagactaaaacacggatataaacgtggaaaaaagcatagcataataattgtg
gcagaaggtgtcaaaccgggagctgaaattggaaaagagattaaagaacgggcaggactc
gataatagggtgactgttctaggtcacgttcaacgaggaggaacgccaactgcttatgat
aggatgttgggtagtcgtttaggggcaaaggcagtggatctcttagttgcaggggaatct
gataaaatgataggaatgagagattacaagcttgttcccgtacaattcaaggatgtattt
agtaaaattgaagaacctgattacgatatttatgagctttctcaaagcctgtcaatctaa

DBGET integrated database retrieval system