Nicotiana tomentosiformis: 104092491 Help Entry 104092491         CDS       T05025                                  Name (RefSeq) ras-related protein RABF1   KO K07889   Ras-related protein Rab-5C Organism nto  Nicotiana tomentosiformis Pathway nto04144   Endocytosis nto04145   Phagosome nto04148   Efferocytosis Brite KEGG Orthology (KO) [BR:nto00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104092491    04145 Phagosome     104092491    04148 Efferocytosis     104092491  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104092491   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nto04147]     104092491    04031 GTP-binding proteins [BR:nto04031]     104092491 Membrane trafficking [BR:nto04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     104092491  Endosome - Lysosome transport     104092491 Exosome [BR:nto04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104092491   Exosomal proteins of other body fluids (saliva and urine)    104092491   Exosomal proteins of colorectal cancer cells    104092491   Exosomal proteins of bladder cancer cells    104092491 GTP-binding proteins [BR:nto04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     104092491 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA MMR_HSR1 AAA_7 RsgA_GTPase AAA_16 TniB Motif Other DBs NCBI-GeneID:  104092491 NCBI-ProteinID:  XP_009596397 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MGCASSVADRNSGRAAGLNPDNGGAVDPKNLKVKLVLLGDSGVGKSCIVLRFVRGQFDPT SKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPES FAKAQYWVKVFLLKNGRVPSFPFVCTHVCMR NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgggttgcgcatcttcagttgcagatagaaattcgggacgggctgctggccttaatcct gataatggtggagcagttgaccctaaaaatcttaaagtgaagctggtactcttgggtgat tctggtgttggtaaaagctgtattgttttgcgctttgtccgtggtcaatttgatccaaca tctaaggtgactgtaggagcttcttttctgtctcaaacaatagcgttgcaggactcaact acagttaaatttgaaatatgggatacagcgggtcaagagaggtacgcagcacttgcacca ctgtactaccgaggtgctgcagttgcagttgttgtgtatgatattactagtcctgagtct tttgccaaagcacaatactgggtcaaggtatttctcttaaagaatggaagggtgccttct ttcccttttgtttgtactcatgtttgtatgaggtga

DBGET integrated database retrieval system