KEGG   Nasonia vitripennis (jewel wasp): 100116149Help
Entry
100116149         CDS       T01081                                 

Gene name
Mes-4
Definition
(RefSeq) probable histone-lysine N-methyltransferase Mes-4
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100116149 (Mes-4)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100116149 (Mes-4)
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100116149 (Mes-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
LinkDB All DBs
Position
2
AA seq 1356 aa AA seqDB search
MPKNSKPEASIEDECTKMDDTSSVMDDTVNNSLDCSSVGVEEDSINIEDLQSQCPWTLGQ
IVWSRIGTYPFWPGIVTIHPETMTYVSERVVGVAKSKVRSVHVTFCADKGKHSWVSFGNV
IPFHGIDDFEKRKEEITPEIKKKDPKYAAAFVIKPSMKLKWDDAVAEASGLMAKSPEARI
EIFKPKNSKNNSLLNKSVKTVDQSEENTKKRKKTFTDDEILTKKSKQEIEEVEILDERLD
NKLGSHLNLETPPTPPSSHKDSSDEGATSKKFKNKKRSGKYGVFEVFCERNKESAEQLDP
DASEADIKAYLLDLWENMSSQERSKYRADYLQSDEVNLYSIDVDEDEEDEEDEDDDEDED
DDDDDYDDDEEAESEPEPEKLAVVNRRQRTKGQLKIDEFFSHEEPLERATRRQRSKAGLN
TTKDEFSDQEEEESTSVESDKSVKKRRTKERRESSDQDDVISIDSGDVPVKKGRSKVDNE
SSKDYPPSLMIDTGKRHRPYKLFKGMKNERVCQICEKTGKLIRCRGPCHSYFHLACVKPG
ESSPEPSEAGDIEENNAYKEDLKEIKAKSKEIQEKEEAAFDYDNFKCIDCLSGVAPPCFV
CHERDGERTKCSILACGKHYHPDCLKSWPQCQWQGGRLTCPHHICHTCASDNPQNSHPRS
AGEKFAKCVKCPSTYHASISCLPAGSTILTGSQIVCPKHYKSSHPPVNATWCFLCTEGGS
LICCDTCPTSFHLECLGIDAPDGGYICEDCETGRLPLYGEVVWVKLGTYRWWPSVICYPQ
EIPTNIATRPHKAGEFCVMFLGTRDYYWIHRGKAFLYQDGDANTKVIGSKKVEESYRKAL
QEAKLFHERLVYERAVAKCRGSSKSLKPPPYVKLKVNKPVGNVKVPEVDSMVACDCNPNQ
PYPCSPDSDCLNRILMIECSPDTCPASTKCQNQLFVQRKYPAMKPAHTEERGWGLVSLEP
IKHGQFIIEYVGEVIDEAEYKLRLQQKKERKNENYYFLTIDNSRMIDAEPKGNLSRFMNH
SCQPNCETQKWKVNGDTRIGLFALRDIEPGEELTFNYNLACDGETRKPCLCKAPNCSGFI
GLKVPKQQMSLVQQKKIEKAEKVKKQRKNSKKVLLSCWNCSQKIDNPDDAHRCDQKTCGK
VYHAHCIAIEDGPDHIFHCPWHFCAECYKRTSIRCSYCCNAFCQLHVFGNLREDPETANL
ICYNHQTENGDYIDLNLGEPGEALMDDDGDDDVVIINDDYNSMETFCDEALEEPLEPPPP
LIPLAAPPSLMPVVMETPASCSVQPDEISPRGAIVEVHASSEEGEEEDESSSQKEDDEDE
TASNKRRRRRRQRRKQNAAESDFTLDQIAAIIGIVK
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaactcaaagccagaagcctccattgaagacgaatgcaccaaaatggacgat
acttcaagtgtcatggatgataccgtcaacaacagccttgattgtagctccgtgggagtt
gaagaagacagcatcaacattgaagatcttcaatcgcaatgtccatggactttgggacaa
attgtttggtccagaattggtacctatccattctggccaggcattgtcacaattcatcca
gaaacaatgacatacgtatcagaaagagttgtaggtgttgcaaagtcaaaagttcggtct
gtgcatgtcacattctgcgcagataaaggaaaacatagttgggtatcttttggaaacgtt
ataccttttcatggaattgatgactttgaaaaacgtaaagaagaaataactcctgaaata
aaaaagaaagatccaaagtacgctgcagcatttgtgatcaaaccctcaatgaaattaaaa
tgggatgatgcagttgccgaagcatcaggcttaatggctaagagtccggaagcaagaatt
gaaattttcaaaccaaaaaatagcaaaaacaacagtttattaaacaaatcagttaaaaca
gttgatcaatcagaagaaaacactaagaagagaaagaaaacttttacagatgatgagatt
ttgactaaaaaatccaaacaagagattgaagaagtagaaattttagatgaaaggttagat
aataaattaggaagtcatttaaatttggaaactccaccaactcctccatcaagccataaa
gactccagtgatgaaggtgccacatcaaagaagttcaaaaataaaaagcgatcaggaaag
tatggagtcttcgaagtattttgcgaacgcaataaagaatcagcagaacagttagaccca
gacgcgtcagaagcagacattaaagcatatttgttagacttgtgggaaaacatgagcagt
caagagcgcagtaagtatagggcggattacctccaaagcgatgaggtaaatttatactcg
atagatgtggatgaagacgaagaagatgaggaagacgaagatgacgatgaagatgaggat
gatgacgatgacgactatgatgacgatgaagaagctgaatccgagcctgagcctgagaaa
ttagcagttgtcaacaggaggcaaagaacaaaaggtcaattaaaaattgatgaatttttc
agtcacgaggagcctttggaaagagctacaagaagacaaagatcaaaagcaggccttaat
acaaccaaggatgagttttcagatcaagaagaagaggagagcacctctgtggaatcggat
aaatccgtaaagaagcgaaggacgaaagaaagacgggaatcctctgatcaggacgacgtt
atatccatagactcgggagatgtacctgtgaaaaagggaaggtccaaagttgacaatgaa
agttcaaaagattatccaccctctttaatgattgatacgggcaagcgacatcgaccctac
aaacttttcaagggcatgaagaacgagcgagtttgtcagatctgcgaaaaaacgggtaag
ctcattcgttgtcgaggcccttgccattcgtacttccatctagcatgtgtaaagccaggc
gagtcaagtcctgagcccagcgaagctggggacatcgaagagaacaacgcctacaaggaa
gatctcaaagaaatcaaggcaaaatccaaggagatccaagagaaagaggaggctgccttt
gactacgataacttcaagtgtatcgactgtctgtctggtgtggcgccgccgtgctttgtc
tgccatgagcgtgatggcgagcgcaccaagtgctcgatacttgcctgcggcaagcattat
cacccggactgtcttaagagttggcctcagtgtcagtggcagggcggtcgactaacctgc
cctcaccacatctgtcacacttgtgcttccgacaatccgcagaatagtcatccaaggtcg
gccggcgagaagtttgcgaaatgcgtgaagtgcccctcgacctatcacgcctctatctcc
tgtttacctgctggttcgactatactgactgggagtcaaattgtctgtccaaaacattac
aaatcgtcgcatccacctgtcaatgcaacttggtgcttcctatgcacagaaggcggcagt
ttaatttgctgcgacacttgcccaacatcgttccatttagaatgtttaggcatagacgca
ccagatggtggctacatttgcgaagattgcgagactggaagattgccgctttatggcgag
gttgtttgggttaaacttggcacttatcgatggtggccttcagttatctgttacccacaa
gaaattcccacgaatattgctacgcgaccgcacaaagctggtgaattttgtgttatgttt
ttgggtacgagggactactattggattcacaggggaaaagcttttctttaccaagatggg
gatgccaatacaaaggtaataggttcaaagaaagtggaggaatcgtatagaaaagcttta
caggaagcaaagcttttccacgaacgtcttgtatatgaaagggctgtagcaaaatgccga
ggcagctccaaaagtctcaaaccacctccttacgtaaagcttaaggtaaacaagcccgtt
ggaaacgtgaaggttcccgaagtcgacagtatggtcgcatgcgactgtaatcccaaccaa
ccatatccgtgttcacctgactcggactgcttgaatcgtatattgatgatcgaatgcagc
ccggatacttgtccagctagtacgaagtgtcagaatcagcttttcgtacagagaaagtat
ccagctatgaagcctgctcatacagaagaacgaggctggggacttgtatctcttgaaccc
ataaagcacggacaattcatcattgaatacgtgggagaagtcatcgatgaagcggaatat
aagcttcgattgcaacaaaaaaaggagagaaaaaacgaaaactattactttttaactata
gataattctagaatgatagatgctgaaccaaagggaaatttaagtcggtttatgaatcat
tcctgtcaacccaattgcgaaacacaaaaatggaaagtcaatggtgatacccgaattgga
ctgtttgccttacgcgatattgaacctggtgaagagttaacttttaattacaatttagct
tgtgatggggagacgcgaaagccgtgtctttgcaaagctcccaattgcagcggttttata
ggtctgaaagttcctaagcaacaaatgagtttagtacaacaaaagaaaattgaaaaggct
gaaaaagttaagaaacagagaaaaaatagtaaaaaggttttattaagctgttggaattgt
agtcaaaagatcgataatcccgacgatgcacatcgatgtgaccaaaagacttgtggcaaa
gtttaccacgcacattgcattgccatcgaagacggcccagatcatatttttcattgccct
tggcatttctgtgccgaatgctacaagagaacgtcaatacgatgtagttattgctgtaat
gcattttgtcagcttcacgtattcggcaatttacgtgaggatcccgagactgctaacttg
atatgctacaatcatcagacagaaaacggagactacatcgatttaaacctgggtgaaccg
ggtgaagctctcatggacgatgatggcgatgacgatgttgtgatcatcaatgatgactac
aatagcatggaaacgttttgtgatgaagctctcgaggagccgttagagcctccaccgcca
ctaataccattagcggcaccgccgtcactcatgccagtggttatggaaacgcctgcatct
tgttctgtgcaacccgacgagatttcgccaaggggcgccatcgtcgaggtccacgcgagc
agcgaagaaggcgaggaggaagatgagtcgtcgtcgcaaaaggaagatgacgaggatgag
acggccagtaataaaagacgccgcaggagacgtcagcgaaggaaacagaacgcggccgag
agcgacttcaccctcgaccagatagcggcgatcatcggcatcgtcaagtga

DBGET integrated database retrieval system