KEGG   Nasonia vitripennis (jewel wasp): 100123549Help
Entry
100123549         CDS       T01081                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100123549
Peptidases [BR:nvi01002]
 Metallo Peptidases
  Family M2
   100123549
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100123549
CD molecules [BR:nvi04090]
 Proteins
  100123549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 777 aa AA seqDB search
MEVVLRPVFVVVVDHRRLHFVTAALLLFLAINQVTCQLDLPPLRDDQRYSDPNNDRYNDR
TSDRYLDRNTDRYADRFNDRNQDQPFNDRNQDQRFNDGRRFPQNDDDRYDRFEGNRRPQD
NRGGIRDDPRFDNRRPVQQIDYANLLAGLDFVGTQRCSNNVAAQWNYETNVNEVSQLQAL
QAQRLYADFQYQTWQQISQIDPNTVREPLIRRRLRYLSAVGPAALPPDQLERYNRLINDM
LTIYNSATICAYKDPLRCGLRLFPEISQTVARSRDWDELQWVWLEWRRRSGSQMKDLYMQ
LVDLNNDAARMNNFTDAAEYWQFPYESFNFEREVDEVWEEIKPLYEELHAYVRRKLRDLY
GPEKISRQAPLPSHILGNIWGQSWVNILDLTLPYPGKNYLDVTQEMQAQGYTPIEMFRAG
EDFFLSLNLSVLPPEFWAGSLIVDPGDRPLICQASAWDFCNGIDYRIKMCTKVTMKDLIT
VHHEMAHIQYFLRYSRLPREFRDGANPGFHEAIGEAVALSVATPKHLQTLGLGNKYIDER
SSDINYLFSLAMEKLVLLPYSIALDKWRWDVFRGVVNREEYNCHWHRLKERYSGTKPPVL
RSEDDFDPGSKYHIPANIPYIRNFVAGVLQFQLYRALCQAAGQRNPEDPRKPLHKCDFYR
SPEAGRILGRLMERGSSVPWQDVLFEATGESRLDPSALREYFRPLEDWLRTENLRTNELV
GWTYDGDYCKRSIETAGLEVYGSGLYQGYYNSGPRVSGALGNSALLGLLLTLALSSF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtgttgaggccggtcttcgtggtcgtcgtcgatcatcggagactgcacttc
gtgacggcagcgctattgctgtttctggccatcaatcaagtaacctgccaattggacctg
ccaccccttcgagacgatcagcgctacagcgatcccaacaatgatcgatacaacgatcgc
acctcggaccggtaccttgatcgcaacaccgatcggtatgccgatcggttcaacgatcgt
aaccaagatcaacctttcaacgatcgcaaccaagatcaacgttttaacgacggtcgccga
ttcccccagaacgacgacgatcgatacgaccgattcgagggtaacagacgaccccaagac
aacaggggaggcataagggacgatcctcgattcgacaaccggcgaccggttcagcaaatc
gattacgcgaacctgctcgccggtctggactttgtcggcacgcagaggtgcagcaacaac
gtcgccgcccagtggaactacgagaccaacgtgaacgaagtctcccagctacaagcgctg
caggcacaaaggctgtacgccgatttccagtatcagacatggcagcagatcagtcagatc
gacccgaataccgtgagagagcctttgatcaggagacgattgagatacctgtcggctgtt
gggccggcggcgcttccaccggatcagctcgagaggtacaatcggctgatcaacgatatg
ctgaccatctacaacagcgcgaccatctgcgcgtacaaggacccgctgcgttgtggtctc
cgcctattccctgagatctcgcagacagtggctcgcagtcgcgactgggatgagctgcaa
tgggtctggctcgagtggcgacgacgaagcggttcccaaatgaaggacctctacatgcag
ttggtcgacctcaacaacgacgctgctcgcatgaacaatttcaccgacgctgcggagtac
tggcagttcccctacgagtccttcaatttcgagcgcgaggtcgacgaggtttgggaggaa
atcaagcctctctacgaggaactccacgcttacgtcagaaggaagctgagggatctttat
ggaccggaaaaaattagccgacaggctccgctgccctctcatattctcggaaacatttgg
ggacagtcctgggtgaacattttggacctcacgctcccctatccgggcaaaaattacttg
gatgtcacgcaggagatgcaagctcagggctacacgccgatcgaaatgttccgcgcggga
gaggacttcttcctgtcgctgaatctgagcgtactcccgccggaattctgggctggaagt
ctgatcgtcgaccccggcgacaggcctcttatctgccaggcttcggcttgggacttttgc
aacggcatcgactacagaataaagatgtgcacgaaggtgacgatgaaggacctgataacg
gtgcaccacgagatggcccacatccagtacttcctgcgctacagccgtctacctcgggag
ttccgcgacggcgcgaatcccggttttcacgaagccatcggcgaggccgtcgccctcagt
gtggctacgcccaagcatctgcagactctgggcttgggcaacaagtacatagacgaacga
tcgtccgacataaattacctgttctcgctggcgatggagaaactagtgctgctgccctac
agcatcgccctggacaagtggcgctgggacgtcttccgcggagtggtcaacagggaggag
tacaactgccactggcatcgactgaaggaacgttactccggcactaagccaccggtgctc
agatccgaggacgacttcgaccccggctccaagtatcacatacccgctaacataccctat
atcaggaatttcgtcgccggggtgctgcagttccagctgtacagggcactgtgtcaagcg
gcgggacagaggaatcccgaggatccgcgcaagcccctgcacaagtgcgatttttacagg
agccccgaagccggcaggatactgggaagactgatggaacgagggtcttcggtgccctgg
caggacgtgcttttcgaggcgacgggcgagtcgagattggacccgtccgcccttagggag
tacttccggccgctcgaagattggctccgcaccgaaaacctcaggaccaacgaactcgtc
ggctggacctatgacggcgactactgcaagcgcagcatcgagacggccggtctggaggtc
tacggcagcggcctgtaccagggctactacaacagcggcccgagggtatcaggcgccttg
ggcaacagcgcgctcctaggcctcctgctgaccctggccttatcctcgttctag

DBGET integrated database retrieval system