KEGG   Nicrophorus vespilloides: 108565519Help
Entry
108565519         CDS       T04922                                 

Definition
(RefSeq) hexokinase type 2 isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108565519
   00051 Fructose and mannose metabolism
    108565519
   00052 Galactose metabolism
    108565519
   00500 Starch and sucrose metabolism
    108565519
   00520 Amino sugar and nucleotide sugar metabolism
    108565519
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108565519
Enzymes [BR:nvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108565519
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MRQKQEIRFCDLQQPLDDEYEISNEIQDRCKELILGDDQLKEVMKRLTDDINKGLGKKTH
ADAIVKCFVTYVQDLPNGTEKGKFLALDLGGTNFRVLLIELGDNHFEMKSKIFAIPQHIM
LGSGEQLFDHIADCLAKFMKEEKVQKEKLPLGFTFSFPLQQLGLTRGMLERWTKGFNCSG
VIGQDVVQLLKDAIARRGDIQITVCAILNDTTGTLMSCAWKNHDCKIGLIVGTGTNACYV
EKQKNAELFDGQDNGSGKVLINTEWGAFGDDGQLDFVRTEYDRDIDEHSINPGKQLHEKM
ISGMYMGELARLVLQKLTKEGLLFNGKGSDPLFTRQRFYTKYVSEIENEPHGTYNNCRQI
LEELGIKHASEQDCVNVRYVCECVSRRAAHLVSAGIACLLNKMDDPTVTVGIDGSVYRYH
PHFHNLMVAKISNLVNKHIKFNLMLSDDGSGRGAALVAAVASRK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaaaacaggaaatccgcttctgcgatctgcagcaaccactcgacgatgaatac
gagatctccaatgagattcaggacagatgcaaggagctgattctcggtgacgatcagctg
aaggaggtgatgaagaggttgacggacgacatcaacaagggtttaggaaagaagacccac
gccgatgccatcgtcaagtgcttcgtcacgtacgtgcaggatcttcccaatggaacagaa
aagggaaaattccttgctcttgatttgggcggaacgaatttccgcgtgctgctgatcgag
ctgggcgataatcacttcgagatgaagtcgaagatcttcgccataccgcagcacatcatg
ctcggatccggggagcagttgttcgaccacatcgccgactgtctggcgaaattcatgaag
gaggagaaggtgcagaaggagaagctgccgctcggattcacgttcagctttccgctgcag
cagctcggattgacgcgcggcatgctcgagagatggacgaaggggttcaactgttccgga
gtcatcggacaggacgtcgtccagctgctgaaggacgccatagcgagacgaggcgacatt
cagataacagtgtgcgcgatcttgaacgacaccacaggcaccctcatgtcttgcgcttgg
aaaaatcatgattgcaaaattggtctcatcgtcggtaccggcacgaatgcgtgttacgtg
gaaaagcagaagaacgctgagctgttcgacggtcaggacaacggatcggggaaggtgctg
atcaacacggaatggggcgcgttcggagatgatggccaattggatttcgttcgcacggag
tacgatcgcgacattgacgagcattccatcaatcccggcaaacaattgcacgagaagatg
atttccggcatgtacatgggcgaattggcgcgtctggtgcttcagaagttgacgaaagaa
ggtctcctgttcaacggcaaaggctcggatccgctcttcaccagacagaggttctacacc
aagtacgtttcggagatcgagaacgaaccgcacggaacgtacaacaattgcaggcaaatc
ttggaggaattgggaatcaagcacgcttcggagcaggattgcgtgaacgtgcgttacgtg
tgcgagtgcgtgtcgagacgcgccgctcacctggtgtccgcgggcatagcctgcttgctc
aacaagatggatgaccccaccgtgaccgtcggcatcgatgggtccgtgtacaggtaccat
ccgcacttccacaaccttatggtcgccaagatctcgaacctcgtcaacaaacacataaag
ttcaacctgatgctctccgacgacggtagcggacgtggcgccgcgttggtggcggccgtc
gcgtcgcgcaaatga

DBGET integrated database retrieval system