Neogale vison (American mink): 122900359 Help Entry 122900359         CDS       T08764                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism nvs  Neogale vison (American mink) Pathway nvs01521   EGFR tyrosine kinase inhibitor resistance nvs01522   Endocrine resistance nvs04010   MAPK signaling pathway nvs04012   ErbB signaling pathway nvs04014   Ras signaling pathway nvs04015   Rap1 signaling pathway nvs04062   Chemokine signaling pathway nvs04068   FoxO signaling pathway nvs04071   Sphingolipid signaling pathway nvs04072   Phospholipase D signaling pathway nvs04137   Mitophagy - animal nvs04140   Autophagy - animal nvs04150   mTOR signaling pathway nvs04151   PI3K-Akt signaling pathway nvs04210   Apoptosis nvs04211   Longevity regulating pathway nvs04213   Longevity regulating pathway - multiple species nvs04218   Cellular senescence nvs04360   Axon guidance nvs04370   VEGF signaling pathway nvs04371   Apelin signaling pathway nvs04540   Gap junction nvs04550   Signaling pathways regulating pluripotency of stem cells nvs04625   C-type lectin receptor signaling pathway nvs04650   Natural killer cell mediated cytotoxicity nvs04660   T cell receptor signaling pathway nvs04662   B cell receptor signaling pathway nvs04664   Fc epsilon RI signaling pathway nvs04714   Thermogenesis nvs04720   Long-term potentiation nvs04722   Neurotrophin signaling pathway nvs04725   Cholinergic synapse nvs04726   Serotonergic synapse nvs04730   Long-term depression nvs04810   Regulation of actin cytoskeleton nvs04910   Insulin signaling pathway nvs04912   GnRH signaling pathway nvs04915   Estrogen signaling pathway nvs04916   Melanogenesis nvs04917   Prolactin signaling pathway nvs04919   Thyroid hormone signaling pathway nvs04921   Oxytocin signaling pathway nvs04926   Relaxin signaling pathway nvs04929   GnRH secretion nvs04933   AGE-RAGE signaling pathway in diabetic complications nvs04935   Growth hormone synthesis, secretion and action nvs05010   Alzheimer disease nvs05022   Pathways of neurodegeneration - multiple diseases nvs05034   Alcoholism nvs05160   Hepatitis C nvs05161   Hepatitis B nvs05163   Human cytomegalovirus infection nvs05165   Human papillomavirus infection nvs05166   Human T-cell leukemia virus 1 infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05170   Human immunodeficiency virus 1 infection nvs05200   Pathways in cancer nvs05203   Viral carcinogenesis nvs05205   Proteoglycans in cancer nvs05206   MicroRNAs in cancer nvs05207   Chemical carcinogenesis - receptor activation nvs05208   Chemical carcinogenesis - reactive oxygen species nvs05210   Colorectal cancer nvs05211   Renal cell carcinoma nvs05213   Endometrial cancer nvs05214   Glioma nvs05215   Prostate cancer nvs05216   Thyroid cancer nvs05218   Melanoma nvs05219   Bladder cancer nvs05220   Chronic myeloid leukemia nvs05221   Acute myeloid leukemia nvs05223   Non-small cell lung cancer nvs05224   Breast cancer nvs05225   Hepatocellular carcinoma nvs05226   Gastric cancer nvs05230   Central carbon metabolism in cancer nvs05231   Choline metabolism in cancer nvs05235   PD-L1 expression and PD-1 checkpoint pathway in cancer nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122900359 (NRAS)    04012 ErbB signaling pathway     122900359 (NRAS)    04014 Ras signaling pathway     122900359 (NRAS)    04015 Rap1 signaling pathway     122900359 (NRAS)    04370 VEGF signaling pathway     122900359 (NRAS)    04371 Apelin signaling pathway     122900359 (NRAS)    04068 FoxO signaling pathway     122900359 (NRAS)    04072 Phospholipase D signaling pathway     122900359 (NRAS)    04071 Sphingolipid signaling pathway     122900359 (NRAS)    04151 PI3K-Akt signaling pathway     122900359 (NRAS)    04150 mTOR signaling pathway     122900359 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122900359 (NRAS)    04137 Mitophagy - animal     122900359 (NRAS)   09143 Cell growth and death    04210 Apoptosis     122900359 (NRAS)    04218 Cellular senescence     122900359 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     122900359 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     122900359 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122900359 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122900359 (NRAS)    04650 Natural killer cell mediated cytotoxicity     122900359 (NRAS)    04660 T cell receptor signaling pathway     122900359 (NRAS)    04662 B cell receptor signaling pathway     122900359 (NRAS)    04664 Fc epsilon RI signaling pathway     122900359 (NRAS)    04062 Chemokine signaling pathway     122900359 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     122900359 (NRAS)    04929 GnRH secretion     122900359 (NRAS)    04912 GnRH signaling pathway     122900359 (NRAS)    04915 Estrogen signaling pathway     122900359 (NRAS)    04917 Prolactin signaling pathway     122900359 (NRAS)    04921 Oxytocin signaling pathway     122900359 (NRAS)    04926 Relaxin signaling pathway     122900359 (NRAS)    04935 Growth hormone synthesis, secretion and action     122900359 (NRAS)    04919 Thyroid hormone signaling pathway     122900359 (NRAS)    04916 Melanogenesis     122900359 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     122900359 (NRAS)    04726 Serotonergic synapse     122900359 (NRAS)    04720 Long-term potentiation     122900359 (NRAS)    04730 Long-term depression     122900359 (NRAS)    04722 Neurotrophin signaling pathway     122900359 (NRAS)   09158 Development and regeneration    04360 Axon guidance     122900359 (NRAS)   09149 Aging    04211 Longevity regulating pathway     122900359 (NRAS)    04213 Longevity regulating pathway - multiple species     122900359 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     122900359 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122900359 (NRAS)    05206 MicroRNAs in cancer     122900359 (NRAS)    05205 Proteoglycans in cancer     122900359 (NRAS)    05207 Chemical carcinogenesis - receptor activation     122900359 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     122900359 (NRAS)    05203 Viral carcinogenesis     122900359 (NRAS)    05230 Central carbon metabolism in cancer     122900359 (NRAS)    05231 Choline metabolism in cancer     122900359 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122900359 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     122900359 (NRAS)    05225 Hepatocellular carcinoma     122900359 (NRAS)    05226 Gastric cancer     122900359 (NRAS)    05214 Glioma     122900359 (NRAS)    05216 Thyroid cancer     122900359 (NRAS)    05221 Acute myeloid leukemia     122900359 (NRAS)    05220 Chronic myeloid leukemia     122900359 (NRAS)    05218 Melanoma     122900359 (NRAS)    05211 Renal cell carcinoma     122900359 (NRAS)    05219 Bladder cancer     122900359 (NRAS)    05215 Prostate cancer     122900359 (NRAS)    05213 Endometrial cancer     122900359 (NRAS)    05224 Breast cancer     122900359 (NRAS)    05223 Non-small cell lung cancer     122900359 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122900359 (NRAS)    05170 Human immunodeficiency virus 1 infection     122900359 (NRAS)    05161 Hepatitis B     122900359 (NRAS)    05160 Hepatitis C     122900359 (NRAS)    05163 Human cytomegalovirus infection     122900359 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     122900359 (NRAS)    05165 Human papillomavirus infection     122900359 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     122900359 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     122900359 (NRAS)   09165 Substance dependence    05034 Alcoholism     122900359 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122900359 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     122900359 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122900359 (NRAS)    01522 Endocrine resistance     122900359 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122900359 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122900359 (NRAS)    04031 GTP-binding proteins [BR:nvs04031]     122900359 (NRAS) Membrane trafficking [BR:nvs04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122900359 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     122900359 (NRAS) Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122900359 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    122900359 (NRAS)   Exosomal proteins of breast cancer cells    122900359 (NRAS)   Exosomal proteins of colorectal cancer cells    122900359 (NRAS) GTP-binding proteins [BR:nvs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122900359 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  122900359 NCBI-ProteinID:  XP_044094901 LinkDB All DBs Position 2:complement(98926525..98936510) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLSSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcagtagcagtgatgatggaactcaaggt tgtatggggttaccttgtgtggtgatgtaa

DBGET integrated database retrieval system