Neogale vison (American mink): 122904168 Help Entry 122904168         CDS       T08764                                  Name (RefSeq) profilin-1   KO K05759   profilin Organism nvs  Neogale vison (American mink) Pathway nvs04015   Rap1 signaling pathway nvs04810   Regulation of actin cytoskeleton nvs05014   Amyotrophic lateral sclerosis nvs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122904168  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122904168  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122904168   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122904168  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122904168   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nvs04812]     122904168    04147 Exosome [BR:nvs04147]     122904168 Membrane trafficking [BR:nvs04131]  Others   Actin-binding proteins    Others     122904168 Cytoskeleton proteins [BR:nvs04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122904168 Exosome [BR:nvs04147]  Exosomal proteins   Proteins found in most exosomes    122904168 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122904168 NCBI-ProteinID:  XP_044100577 LinkDB All DBs Position 4:224742082..224742859 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtttgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccgatcaagttttttc gtgaacgggctgacacttgggggccagaaatgttctgttatccgggactcactgctgcag gatggggagtttaccatggaccttcgtaccaagagcaccggtggagcccccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system