Neogale vison (American mink): 122911430 Help Entry 122911430         CDS       T08764                                  Name (RefSeq) metallothionein-1E-like   KO K14739   metallothionein 1/2 Organism nvs  Neogale vison (American mink) Pathway nvs04978   Mineral absorption Brite KEGG Orthology (KO) [BR:nvs00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     122911430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:nvs03019]     122911430    03029 Mitochondrial biogenesis [BR:nvs03029]     122911430 Messenger RNA biogenesis [BR:nvs03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      122911430 Mitochondrial biogenesis [BR:nvs03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     122911430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  122911430 NCBI-ProteinID:  XP_044112043 LinkDB All DBs Position 7:complement(27167674..27168360) Genome browser AA seq 61 aa AA seqDB search MDPNCSCGTGGSCTCAGSCKCKECKCSSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcttgcggtacaggtggctcctgcacgtgtgctggctcctgcaaa tgcaaagaatgcaaatgcagttcctgcaaaaagagctgttgctcctgctgcccggtgggc tgtgccaagtgcgcccagggctgcatttgcaaaggggcgtcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system