KEGG   Nitrosococcus watsonii: Nwat_2339Help
Entry
Nwat_2339         CDS       T01266                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nwa  Nitrosococcus watsonii
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nwat_2339
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_2339
   00680 Methane metabolism
    Nwat_2339
Enzymes [BR:nwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Nwat_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2543864..2546737
Genome map
AA seq 957 aa AA seqDB search
MTSMKQQTPETHPAPQEQAGNTTPWRDKELRARVKLFGNLLGQVIQSQSGEKVFAAVEAL
RKGYINLRKQENPDKRIQLLRLIDTLDVKKITQVVRAFSIYFSLANIAEEAYQHRQRQRR
IDAGGSLWRGSFEKTLQEIRESGVNPEQLQIMLDNLAYIPVITAHPTEAKRRTVMEHLRK
IFLAGKLLDEMRLSQREEEALHRQLERQIQVLWKTDEVRAHRPQVQDEIINGLFYFKVSL
FQAVPETYRQLEEAINKVYGDMLPENTTLRVPSFLHFGSWIGGDRDGNPNVTPEVTAMAV
RLQMRMALEHYVACLTQLTRILTHSIPLIRPSTALTESIHQDLSDCPETFRGDPDRFSRE
PYRRKLYLMRYRLLDNLRAVEQYLQPENQPTPPQGVGYPSEERFLEDLYLLRDSLRSHGD
GNIAARELQDLIRLVESFGFYLLKLDVRQESGRHTEAVAELIKHLELHPSYLDLSETERL
EFLSEQLAREEEITIQREQLTSATRETLELFHVMAQMRQEVSPRVFGHYVISMTHAASHV
MEVMYLGHLAGLAGRRQGQWHCGLQISPLFETIEDLEHIEPVMTALLDDSSYQALLRAAG
NQQEVMIGYSDSCKDGGILSSSWKLYDAQKRVTALTGSRGIDCRIFHGRGGTIGRGGGPT
FDAILSQPQGTVHGQIKFTEQGEVLSSRYSNPETAIYELNMGISGLIKASTCLVQPPREE
KRDYLGIIDSLVETGEQTYREFTEQTPGFQDYFYEATPVNEIGLLNIGSRPPHRKKGDRS
KNSVRAIPWVFGWAQARHTFPAWYGIGSALEKWRAGAPDRLAKLQAMYEEWPYFRALLSN
TQMSLAKAELHIAQQYAGLCLDPETGQKIFALLRAEYQRTVTQVLHIVGARALLEENPPL
ALSLQRRDPYLDPLNHIQLTLLKRTRDPQITPEEREAWLDPLLRSINAIAAGMRNTG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgacatccatgaaacaacaaacacctgaaacccatcccgcgccccaagagcaggcggga
aacaccacgccctggcgggataaggaactgcgcgctcgcgtcaaactatttggcaacctc
ctgggtcaggtcatccaaagccagtcgggggaaaaagtattcgccgctgtcgaggccttg
cgcaagggctacattaacctgcgcaaacaagaaaatcctgacaaacgaatccaattgcta
cgccttatcgacacgctggatgtgaagaaaatcacccaggtagtgcgggcctttagcatc
tactttagcctcgccaacattgccgaagaagcttaccaacaccgacagcgacaacgccgc
atcgatgcaggtggatctctttggcgaggctccttcgaaaaaactctacaggagatccgg
gaaagcggagtgaatcccgaacagctccaaattatgctggataatttggcctatattccc
gtcattaccgcccatcccaccgaagccaagcgccgcacggtgatggaacatctgcgcaaa
atcttccttgccggtaaacttctggacgagatgcgcctcagtcagcgggaggaagaagcc
ctccaccgccaattagagcggcagatccaggtcctgtggaagaccgatgaagttcgcgcc
caccggcctcaagtccaggacgaaatcatcaacggcctcttctatttcaaggtcagcttg
ttccaggccgtacccgaaacctaccgccagctagaagaagccatcaacaaagtctatggt
gacatgctaccggagaacaccacgcttcgggtccccagctttttacactttggctcttgg
atcggcggagaccgggatggcaaccccaatgtcacgccggaagtcaccgccatggccgtg
cgattgcaaatgcggatggccctagaacattatgtcgcctgccttactcaattgacgcgt
attctcacccattccattcctcttatcaggccctcaacggccctgacggaaagtattcac
caggatttgagcgattgtccggagacttttcggggcgatcctgaccgctttagccgcgaa
ccctaccggcgcaagctctacctgatgcgctatcgtttgctggataacctgcgggctgtg
gaacaatatctgcagccagaaaaccaacctacccccccgcaaggcgtcggttatccttcc
gaggaacggtttctcgaggatctctatctccttcgcgacagcctgcgcagccatggtgac
ggcaatattgccgcacgggaattgcaagatctaattcgcctggtagaaagctttggcttt
tacctcctcaaactcgatgttcgccaggaatcaggccgccatactgaagcagtggcagaa
ttaattaaacatctcgaactgcaccccagctatcttgatctttccgaaactgaacggcta
gagttcctctccgaacaactcgcccgcgaagaagaaatcaccatccagcgggagcagctt
acctccgctacccgggaaacactggaactctttcacgtcatggcgcaaatgcgccaggaa
gtaagcccccgggttttcggtcattacgtgatttccatgacccacgccgctagccatgtc
atggaggtcatgtatctaggccatcttgctggcctcgccggacgccggcaggggcaatgg
cattgcggtctacaaatctcccccctgtttgaaaccatcgaggatttagaacatatcgag
ccggtcatgaccgccctgcttgatgattccagctatcaagccttgctccgcgccgccggc
aaccagcaagaagtcatgattggctactcggactcctgtaaggacggcggtatcctgtcc
tcctcctggaaactatatgacgcccaaaagcgggtcacggcccttaccggcagccggggg
atagattgccgtatctttcatggccgaggcggaaccattggccggggtggtggccctact
tttgacgctatcttgtctcaaccccaggggactgtccacggtcaaatcaaatttacggag
cagggagaagtcctctcttcccgctacagcaaccccgagaccgcgatttatgagctcaac
atgggtatcagtggcctgattaaggccagcacttgtctcgttcaacctccccgagaagaa
aagcgcgattatctcggcatcatcgactcgttagtggaaacaggcgagcagacttaccgg
gaattcacggaacaaacgcctggctttcaagattatttctatgaagccaccccggtcaat
gaaattggcctattgaacattggctcccgtccccctcaccggaaaaagggagatcgttcc
aaaaactcggtccgggccatcccttgggtctttggctgggcccaggcccggcatactttt
cccgcctggtatggtatcggcagtgccttggaaaagtggcgggccggcgctcctgatcgg
ctcgccaaactccaggccatgtatgaagagtggccctatttccgcgccctgctcagcaat
acccaaatgtccctggccaaggctgagttgcacatcgctcagcaatacgccggcttgtgc
ctagatccggaaacgggacagaaaatattcgccctgctcagggcggagtaccaacgcacg
gtcacccaggtgctccatatcgtgggagcccgcgccctgctggaggaaaatcctcccctg
gccctgtccctgcaacgccgggacccttatctggaccccctcaatcatatccagctcacc
ctgcttaaacgcacccgcgatccacaaatcactcccgaggaacgggaagcgtggcttgat
cctctgctccgctccatcaatgccatcgcggccggaatgcgcaatacgggctga

DBGET integrated database retrieval system