KEGG   Ornithorhynchus anatinus (platypus): 100085175Help
Entry
100085175         CDS       T01045                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100085175 (SUV39H2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100085175 (SUV39H2)
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100085175 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100085175 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 405 aa AA seqDB search
MTYTVAWCVPCLASFDTLQELCRKEKLTCKSIGITKRNLNNFEVEYLCNYKVEKDMEYYL
VKWKGWPESTNTWEPLENLKCPLLLKQFFNDQRVYLTKMKQGKVITLKNNVKILRPALAK
YIVKKAKQRIALQRWQEELNRKKNHDGMIFVENTVDLEGPPIDFYYINEYKPAPGINLVS
EATVGCVCTDCFFEKCCPAEAGVHLAYNKNNQIKIQPGTPIYECNSQCQCGPDCPNRIVQ
KGTQYSLCIFRTSNNCGWGVKTLEKIKRMSFVMEYVGEVITSEEAERRGQLYDDKGITYL
FDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTIKAG
EELTFDYQMKGSGDLSSESIDLSPAKKRVRTVCKCGSVSCRGYLN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacctatactgtagcttggtgtgtgccatgtctagcttcatttgacaccctccaggaa
ttgtgtagaaaagaaaaactcacatgtaaatcgattggaatcaccaaaaggaatctaaac
aattttgaggtggaatacttgtgtaactacaaggtagaaaaggatatggaatattacctt
gtaaagtggaaaggatggccggagtccacaaacacctgggagcctctggaaaatctcaaa
tgtccattgcttcttaaacaattctttaatgaccagcgtgtgtatttgacaaagatgaag
caagggaaagtaataactctaaagaacaatgttaagattttgaggcctgcgcttgccaag
tatatcgtaaagaaggcgaaacaaaggatagctctgcagaggtggcaagaagaactcaac
cgaaaaaagaaccacgatggaatgatatttgtcgaaaacactgtggacctggagggtccc
ccgatagacttctactacattaatgaatataaacccgcccccgggatcaatttagtaagc
gaagccacagtcggctgtgtttgcactgactgcttctttgaaaagtgttgcccggccgaa
gctggagttcacttggcatataataaaaacaaccagatcaaaatccagccaggcaccccc
atctacgaatgcaactcccagtgccagtgcggacccgactgcccaaatcggatcgtgcag
aaaggcacgcagtactcactgtgcatctttcgaactagcaacaactgtggctggggagtg
aaaaccctggagaaaattaagaggatgagtttcgtcatggagtatgtcggagaggtaatt
acaagtgaggaagcagagagaagaggacagctctatgacgataaaggaatcacatatctc
tttgatttggactatgaatctgatgaatttacagtggatgcagcgcgatatggaaatgtg
tcacattttgtgaatcatagttgtgacccaaatctccaggtattcaatgtcttcatcgat
aatcttgatactcgtcttcctcggatagcattattttctaccagaacaataaaggctgga
gaagaactcacgtttgattaccagatgaaaggttctggagacttgtcttctgagtccatc
gacctcagtccagccaaaaagagagtcagaactgtgtgcaagtgtggttctgtgtcttgc
agaggttacctcaactaa

DBGET integrated database retrieval system