KEGG   Ornithorhynchus anatinus (platypus): 100086459Help
Entry
100086459         CDS       T01045                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100086459
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100086459
   04974 Protein digestion and absorption
    100086459
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100086459
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100086459
Peptidases [BR:oaa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100086459
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100086459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MKFILLLALLGAAVAFPLDDDDDKIVGGYTCTKNSLPYQVSLNSGYHFCGGSLIDKKWVV
SAAHCYKSQIQVRLGEHNINEIEETEQFINSSLVIRHPNYDSWVLDNDIMMIKLSTPAAL
NSRVASVSLPSSCVEAGTKCLISGWGNTLSSGTDYPSLLQCLDAPVLSEFDCRNAYAGQI
TRNMMCLGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCAQKGRPGVYTKVCNYVSWI
RNIIRTS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcattctcttattagcccttttgggggcagctgtggccttccctttggatgat
gatgatgacaagattgttgggggttacacctgtaccaagaactctctcccctaccaggta
tccctcaacagtggctaccacttctgtggtggctccctcatcgacaagaagtgggtcgtg
tctgctgctcactgctacaaatcccaaatccaggtgagactgggtgagcacaacattaat
gaaattgaagagactgagcagttcatcaactcctccctggtcattcgccatcccaactat
gatagctgggttctggacaacgacatcatgatgatcaagctgtcgacccccgctgccctc
aacagccgtgtagcttctgtctccctgccctcctcctgcgtggaggccgggaccaagtgc
ctgatatccggctggggcaacaccctcagctctggcactgactacccctcgctgcttcag
tgcttggatgcccctgtgctatccgagtttgattgccgcaatgcctacgccgggcagatc
accagaaacatgatgtgcctgggcttcttagagggtggcaaggacgcctgccagggtgac
tccggtggccccgttgtctgcaatggcgagctccagggtatcgtctcttggggctacggt
tgtgcccagaaaggcaggcccggtgtctacaccaaggtctgcaactatgtcagctggatc
agaaacatcattagaacttcctaa

DBGET integrated database retrieval system