KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2701Help
Entry
Oant_2701         CDS       T00568                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Brite
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Oant_2701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABS15413
JGI: Oant2701
UniProt: A6X2F9
LinkDB All DBs
Position
1:2836812..2837408
Genome map
AA seq 198 aa AA seqDB search
MAFELPALPYDYDALAPFMSRETLELHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES
YGKNQGLFNNAGQHYNHILFWKWMKKNGGGKKLPGKLEKAIESDLGGYDKFRADFIAAGV
GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGATPILGVDVWEHSYYVDYRNLRPKYLEA
FVDSLINWEFVEELYEKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgcccgccctgccgtatgactatgacgcccttgcgcctttcatgtcg
cgcgagacgcttgaacttcatcacgacaagcaccatcaggcctatgtcaccaacggcaac
aagctgctcgaaggctccggcctcgaaggcaagagcctagaagagatcgtcaaggaaagc
tacggcaagaaccagggcctcttcaacaatgccggccagcactacaaccacatcctgttc
tggaagtggatgaagaagaacggtggcggcaagaagctgccgggcaagcttgaaaaggca
atcgagtccgatcttggcggctatgacaagttccgggcggatttcatcgctgccggcgtc
ggccagttcggttcaggctgggcctggctgtcagtcaaggacggcaagcttgaaatctcc
aagaccccgaacggcgaaaacccgctggttcatggcgcaacgccgatcctcggcgtcgac
gtgtgggaacattcctactatgtcgattatcgaaatctgcgtccgaagtacctcgaggcc
ttcgtcgatagcctcatcaattgggaattcgtcgaagaactgtacgaaaaggcctga

DBGET integrated database retrieval system