KEGG   Ovis aries (sheep): 554335Help
Entry
554335            CDS       T03117                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
oas  Ovis aries (sheep)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:oas00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    554335 (ACE)
   04614 Renin-angiotensin system
    554335 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    554335 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    554335 (ACE)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     554335 (ACE)
Peptidases [BR:oas01002]
 Metallo Peptidases
  Family M2
   554335 (ACE)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   554335 (ACE)
CD molecules [BR:oas04090]
 Proteins
  554335 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
11
AA seq 1100 aa AA seqDB search
MASPVYPLVPSWCPQEEAALLSQEFSEAWGQKAKGLFDPVWQNFTDPTLLRIIGAVRTLG
PANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELTNVLASSRSYALLLYA
WEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSWYDSPTFTEDLERLYQQLE
PLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGNMWAQSWENVYDMVVPFPDKPNLDV
TSAMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCHASAWDFYN
RKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQHVSLRRGANPGFHEAIGDVLALSV
STPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRY
NYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEA
GHQGPLHQCDIYQSTQAGAKLRALLQAGSSRPWQEVLKDMVGSDNLDARPLLSYFQPVTQ
WLEEQNQQNGEVLGWPEYQWRPPTPDNYPEGIDLVSDEAEARKFVEEYDRRSQVVWNEYA
EANWNYNTNISTDNSKLLMQKNLQMANHTVKYGTWARRFDVTNFQNATMKRMIKKIQDLE
RAALPVKELEEYNQILVDMETVYSVASVCHKNGTCLRLEPDLTRLMATSRNYQDLAWAWK
SWRDKVGRSILPYFPKYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQLFQELQPL
YLNLHAYVRRALHHHYGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPSAPKMDATE
AMIKQGWTPLRMFKEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFFNGK
DFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVST
PTHLHKIGLLSSGDGSYEEDINFLMKMALDKIAFIPFSFLVDQWRWRVFDGSVTRENYNQ
EWWSLRLKYQGVCPPLARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQALCQAAGH
QGPLHKCDIYQSKEAGKLLA
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccctgtttaccctctcgtgccctcctggtgcccacaggaggaagcagccttg
ctcagccaggagttttcagaggcctggggccagaaggccaagggtctgtttgacccggtc
tggcagaactttaccgaccccacgctgctgcgcatcatcggggcggtgcgcaccttgggc
cccgccaacctggacctagagaagcggcagaagtacaactctctgctaagcaacatgagc
aggatttactccaccgccaaggtctgcttccccaacaagactgccccctgctggtccctg
gacccagagctcaccaacgtcctggcttcctcacgaagctacgccctgctgctgtatgcc
tgggagggctggcacaacgctgcgggcatcccactgaagcccctataccaggacttcact
gccctcagcaacgaggcctacaagcaggatggcttctcagacacaggggcctactggcgc
tcctggtacgactctcccaccttcacggaggatctggaacgcctctaccagcagctggag
cccctctacctgaacctccatgcctacgtccggcgtgcactgcaccgccgatatggggac
agatacatcaacctcaggggacccatccccgctcacctgctggggaacatgtgggcccag
agctgggagaatgtctacgacatggtggtgcccttccccgacaagcccaatcttgatgtt
accagtgctatggtgcagaagggctggaacgccacacacatgttccgggtggcggaggag
ttcttcacctccctggggctcttgcccatgccacccgagttctgggcggaatccatgctg
gagaagccaagcgacgggcgggaggtggtgtgccacgcgtccgcctgggacttctacaac
aggaaagacttcaggatcaagcagtgcacacgggtcactatggaccagctgtccacggtg
caccacgagatgggccacgtgcagtactacctgcagtacaaggaccagcacgtctccctg
cgccgaggcgccaacccaggcttccacgaggccatcggcgatgtgctggccctctccgtc
tccactcctgcacacctgcacaagatcggcctgctggaccaggtcaccaacgacacagag
agcgacatcaactacttgttaaagatggcactggaaaaaattgccttcctgccctttggc
tacttggtggaccagtggcgttggggggtctttagtgggcgaacccccccttcccgctac
aactatgactggtggtatcttcgaaccaagtatcaggggatctgtcctccggttgtccga
aacgaaacccactttgacgctggagccaaatttcacgtcccaaatgtgaccccatatatc
aggtacttcgtgagctttgtcctgcagttccagttccacgaagcgctgtgcaaggaggca
ggccaccaaggccccctgcaccagtgtgacatctaccagtccacccaggcgggggccaag
ctccgggcgctgctgcaggcaggctcctcacggccctggcaggaggtgctgaaggacatg
gtcggctcagacaacctggacgctaggccgctgctcagctacttccagccggtcacacag
tggctcgaggagcagaaccagcagaacggcgaggtcctgggctggccagagtatcagtgg
cgcccgccgacgcctgacaattacccggagggcattgacctggtgtccgacgaggccgag
gcccgcaagtttgtggaggaatatgaccggagatcccaggtggtgtggaatgagtatgcc
gaggccaactggaactacaacaccaacatcagcacggacaacagcaagttgctgatgcag
aagaacttacagatggcaaaccacaccgtcaagtatggcacctgggccaggaggttcgac
gtgaccaacttccagaatgccaccatgaagcggatgataaagaagattcaggatctagaa
cgggcggcactgcccgtcaaggagctggaggagtacaaccagatcctggtggacatggag
accgtttacagcgtggcttctgtgtgccacaaaaatggcacctgcctgcggctcgagcct
gatctgaccaggctgatggccacatcccggaattatcaggacctggcctgggcgtggaag
agctggcgcgacaaggtggggcggtccattctcccctacttccctaaatatgtggagctc
accaacaaggccgccaggctcaatggctaccaggatggcggggactcctggaggtccatg
tacgagatgcccttcctagaggaggagctggagcagctgttccaagagctgcagccgctc
tacctgaacctgcatgcctatgtgcgccgggccctgcaccaccactacgggcccgacgtc
atcaacctggagggccccatcccagcccacctgctcgggaacatgtgggcacagagctgg
tccaacatctatgacttggtggcacccttcccttcagcccccaagatggatgccacggag
gccatgataaagcagggctggacacccctaaggatgtttaaggaagcagacaatttcttc
acttccctggggctgctgcccatgccccccgagttctggaacaagtcgatgctggagaag
ccgactgatgggcgggaagtggtgtgccatgcctccgcctgggacttcttcaacggcaag
gactttaggatcaagcagtgcacctcagtgaacatggaagacctggtggtggcccaccac
gaaatgggccacatacagtacttcatgcagtacaaggacttgcccgtgaccttccgggag
ggcgccaaccccggctttcacgaggccattggggacgtgctggccctctcagtgtccacc
cccacgcacctgcacaagatcggcctgctgagcagcggggacggcagctacgaggaggat
atcaactttctgatgaagatggcgcttgacaagatcgccttcatccccttcagcttcctc
gtcgaccagtggcgctggagggtgtttgacggaagtgtcaccagggagaactacaaccag
gagtggtggagcctcaggctgaagtaccagggtgtctgtcccccgctggccagatctcaa
gacgactttgacccaggggccaagttccacattcctgcaagtgtgccttatgtcaggtac
ttcgtcagcttcgtcatccagttccagttccaccaggcactgtgtcaggcggcgggccac
cagggccccctgcacaagtgtgacatctaccagtccaaggaggccgggaagctcctggcg
tga

DBGET integrated database retrieval system