KEGG   Octadecabacter antarcticus: OAN307_c00690Help
Entry
OAN307_c00690     CDS       T02538                                 

Definition
(GenBank) ribulose bisphosphate carboxylase-like protein
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
oat  Octadecabacter antarcticus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OAN307_c00690
Enzymes [BR:oat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OAN307_c00690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
71733..72992
Genome map
AA seq 419 aa AA seqDB search
MTRLTATYEIESPVGVQRAAEVMAGEQSTGTFVRLASETDALRDRSAARLDHVDITGTSE
HPALPCRLSAETYEQGRVTISWPMDNFGPSLPNILATVAGNLFELAELSAIRLVDLGIPD
ALAKGCPGPQFGITGTRKLMGVPSGPMIGTIIKPSVGLSAEQTAALAGDLAQAGIDFIKD
DELQGNGPACPFDGRAKLVMDVLNEAAQKAGRKVMYAFNITDEIDVMRRNIDLLESLGAT
CAMVSLNSIGLAGLRAIRDHSPLPIHAHRNGWGLMSRSPHVGIKYLAMQKLWRLAGSDHL
HVNGLGNKFTEGDTVVTNAARAVQAPLNGATPHAALPVFSSGQTAWQVGPSMELLGNDDF
LFCAGGGIMSHPYGPAVGITSLRQAAAAQKAGEKVEDYAKDHPELAAALTTFKSAVNRS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttgacagcaacctatgaaatcgaaagccccgtgggcgtgcagcgcgccgcc
gaagttatggcaggtgagcaatcgacaggcaccttcgtgcgtctcgcatccgagaccgac
gccctgcgcgaccgctctgccgcacggctggatcatgttgatatcacaggcacctctgag
catccggccttgccatgcaggctaagcgctgagacctacgaacaaggccgcgtcacgatc
agttggccgatggacaactttggcccgtccttgcccaatatccttgccactgttgcaggc
aatttatttgaattggctgaactctctgcgatccgacttgtggatttaggcatacctgat
gcgctggcaaaagggtgtcccggtcctcaatttggaattaccggtacgcgaaagctgatg
ggtgtgccaagcggcccgatgatcgggacgattataaaaccaagcgtgggcttaagtgcc
gaacaaaccgccgctcttgccggtgatctggcgcaggccggcatcgatttcatcaaggat
gacgagttgcaaggtaacggccccgcatgtccgtttgacggccgcgccaaactggtgatg
gacgttttgaacgaagcagcgcaaaaggcagggcgcaaggtgatgtatgccttcaatatc
accgacgagattgacgtgatgcgccgcaacattgacctgctcgaaagccttggtgcgacc
tgtgccatggtatcgctgaactctatcggcttggcgggcttgcgggcgatacgcgatcac
agcccgctgccgatccatgcgcatcgtaacggatgggggctaatgtcgcgctcgccacat
gtggggatcaaatatcttgcaatgcaaaaactgtggcgactggcgggcagcgatcatctg
cacgtgaacggtttgggcaacaagtttacggaaggtgacaccgtcgtaacaaatgccgcg
cgcgccgtacaagcgcccctaaacggcgccacaccacacgccgcgttgccggtgttttcg
tcgggccaaaccgcgtggcaagtcgggccgtcgatggaattactcggtaacgacgatttc
ctgttctgcgcaggcggcggaatcatgagccacccatacggaccagcggtaggcatcacc
agtttacgccaagccgccgccgcacaaaaagcaggtgagaaagtcgaagactacgccaaa
gatcaccccgaattggcggctgcattgacgacattcaaaagtgctgtgaaccgcagctag

DBGET integrated database retrieval system