KEGG   Octadecabacter antarcticus: OAN307_c44330Help
Entry
OAN307_c44330     CDS       T02538                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
oat  Octadecabacter antarcticus
Brite
Translation factors [BR:oat03012]
 Eukaryotic Type
  Elongation factors
   OAN307_c44330 (tufA)
 Prokaryotic Type
   OAN307_c44330 (tufA)
Mitochondrial biogenesis [BR:oat03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    OAN307_c44330 (tufA)
Exosome [BR:oat04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OAN307_c44330 (tufA)
  Exosomal proteins of breast cancer cells
   OAN307_c44330 (tufA)
  Exosomal proteins of colorectal cancer cells
   OAN307_c44330 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGI69799
UniProt: M9RAX5
LinkDB All DBs
Position
complement(4356449..4357624)
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFKAYDQIDGAPEEKARGITIST
AHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPEMVVYMNKVDQVDDDELLELVEMEIRELLSKYDYNGDDIPVIPGSALHAMNGTMPE
IGEDSIRKLMEAVDTFIPTPEGAIDQPFLMPVEDVFSISGRGTVVTGRIERGVINVGDEI
EIVGIRDTSKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDREGVERGQILCKPKSVMPHT
KFEAEAYILTKDEGGRHTPFFANYRPQFYFRTTDVTGTVNLPEGTEMVMPGDNLKFEVEL
IAPIAMEDGLRFAIREGGRTVGAGVVSKILA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcaaagtttgaacgtaataaaccacacgttaacatcggcacgatcggtcac
gttgaccacggcaagacgacgttgacagcagcgatcaccaagtattttggtgaattcaaa
gcgtatgaccagattgatggtgcgccagaagaaaaggcccgtggcattacaatctccacg
gcccacgtggaatatgagactgaagcgcgtcactacgcccacgtcgactgccccggccac
gccgactacgtcaaaaacatgatcaccggtgctgcgcaaatggacggcgcgatcttggtt
gtgaacgcggctgatggcccaatgccacagacccgtgagcacatcctgctcggtcgtcag
gtcggcatccctgagatggtcgtctacatgaacaaggttgatcaggttgacgacgatgag
ctgcttgagctggtcgagatggaaatccgcgagctgttgtcaaagtatgactataatggc
gacgacattccagtgatccccggttccgctctgcacgcgatgaacggcacgatgcctgaa
atcggcgaagattccatccgcaagttgatggaagctgtcgatacgttcattccaacgccc
gagggtgcgattgaccagccgttcctgatgccggttgaggacgtgttctcgatttcgggt
cgtggtaccgttgtgacgggtcgcatcgaacgtggcgtgattaacgtgggcgacgagatt
gaaatcgtcggtatccgcgacacgtcaaagacgacctgtacgggcgttgaaatgttccgc
aagctgttggatcgtggtgaagctggcgacaacatcggcgcattgctgcgcggtgttgat
cgcgaaggcgtcgagcgcggccagattttgtgtaagcctaagtcggtgatgccgcacacg
aagttcgaggccgaggcgtatatcctcaccaaggacgagggtggccgtcacacgccattc
ttcgcgaactaccgcccgcagttttacttccgcacgacggacgtgacgggcaccgtgaac
ctgcccgagggcacagaaatggtgatgcctggcgataacctgaagttcgaagtcgaactg
atcgcaccgatcgcgatggaagacggccttcgcttcgccatccgcgaagggggccgcact
gttggtgctggtgtcgtgtcaaagatactcgcttaa

DBGET integrated database retrieval system