KEGG   Octopus bimaculoides: 106878013Help
Entry
106878013         CDS       T04127                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
obi  Octopus bimaculoides
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:obi00001]
   00010 Glycolysis / Gluconeogenesis
    106878013
   00051 Fructose and mannose metabolism
    106878013
   00052 Galactose metabolism
    106878013
   00500 Starch and sucrose metabolism
    106878013
   00520 Amino sugar and nucleotide sugar metabolism
    106878013
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106878013
Enzymes [BR:obi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106878013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 474 aa AA seqDB search
METYSRTDSCGSQGRSKRPRSIETIVRPFKLNDMNYREIMHLMIEKFKEGLSAKTNPIAS
VKMFPTYVRSTPKGTEVGDFLALDLGGTNFRVLHIKLDGQDTKMESKIFLIPQKIMSGTG
AELFDHIADCIYKFVKEQQLLTHYLPLGFTFSFPCRQEGLDRAILTTWTKGFKCEGVEGE
NIVELLHAAIKRKGQLNIKCVAVINDTVGALMSCAHSDRMCSVGIILGTGTNACYIERLE
NVDIWNEDKNEPKQVIINTEWGAFGDDGCLDKILTDYDRQVDKHSINPGKQRFEKTISGM
YMGELVRLILEKLRRHKLIFNGVGSEELSTRGRFYTKYVSEIESDIDDSFKNTKQVFQDL
NLTNFMVEDCRIAQYVCSTISTRAAYLSAAGTAALIHKMGRSEVTVAVDGSLYRFHPHFH
DLMVEKIKALCPLTRFRLMLSHDGSGKGAAIVASCATQEGQNQNNNSALRAEVH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttatagtaggactgatagttgtggtagccaaggacgttccaagcgacctcga
agtattgaaactatagtgcggccattcaagcttaatgacatgaattaccgggaaataatg
catttgatgatcgagaagttcaaggagggtttgagtgctaagactaacccaatagcctct
gtgaaaatgtttccaacatatgttcgatcaactccgaaaggaacagaagttggagatttc
cttgctctggatttaggtggcacaaacttccgtgtacttcatatcaaacttgatggtcaa
gacactaaaatggaaagtaaaatatttctgattcctcagaagattatgtctggaactgga
gccgaactctttgatcacatagcagattgtatatataaatttgtcaaagagcagcagctg
ttgacacattatttacctttgggcttcacattttcatttccttgtcgacaagaaggtctt
gatagagcaattcttaccacttggacgaaaggatttaagtgtgaaggagtggagggagaa
aatattgtggaattattacatgctgcaataaaacggaaaggacaacttaatattaaatgt
gtggctgtgatcaacgatactgttggagccctgatgtcttgcgcccacagtgaccgaatg
tgttctgttggtattatattaggtacaggtactaatgcttgttatattgagagactggaa
aatgtcgacatttggaatgaagataaaaacgaaccaaaacaagttataattaacacagaa
tggggtgcatttggagatgatggctgtttggacaagattctaacagattacgacaggcag
gttgacaagcattccatcaacccaggaaagcaacgatttgagaagacaatatctggaatg
tacatgggggaacttgtccgtcttatacttgaaaagttacgcagacataaactgattttc
aatggcgttggctcagaagagttatcaactcgtggacggttttacacaaaatatgtttct
gaaattgaaagtgatattgatgatagcttcaaaaatactaaacaggtctttcaagatctt
aacttaacaaactttatggtggaagattgtcgtatcgctcagtatgtctgctcaactatt
tccacacgagctgcctatttatctgccgcaggtactgctgctttgattcacaagatgggt
cgatctgaagttactgttgctgtagatggctctctctacagattccatcctcattttcat
gacttaatggtagaaaaaattaaagcactttgtccccttactagatttcgtctgatgctg
tcccatgatggaagtggaaaaggtgcagcaatcgttgcaagttgtgctacacaagaaggc
cagaatcaaaacaacaattctgcattaagggcggaagttcattga

DBGET integrated database retrieval system