KEGG   Oryza brachyantha (malo sina): 102722327Help
Entry
102722327         CDS       T02995                                 

Definition
(RefSeq) probable glutathione S-transferase GSTU1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102722327
Enzymes [BR:obr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102722327
Transporters [BR:obr02000]
 Other Transporters
  Pores ion channels [TC:1]
   102722327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 225 aa AA seqDB search
MADEVVLLDFWVSPFGQRCRIALAEKGVEYEYSEQSLADKSDLFLRSNPVHKKVPVLLHG
GRPVCESLAILEYIDEAWPEKAPPLLPAAADDPYGRARARFWADYVDKRLFDCQTRLWKL
RAGEDGHEQAKRDMVDALRALEAELGDRVYFGGEAFGYLDVVLVPFAAWFHAYERLGGFA
VAEHCPRLVAWAERCKERDSVAATLSDPGKVYEFALYLKDKFGAK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggttgtgcttctcgacttctgggtgagcccgttcgggcagcggtgccgg
atcgcgctggcggagaagggcgtggagtacgagtacagcgagcagagcctcgccgacaag
agcgacctcttcctccgctccaacccggtccacaagaaggtccccgtcctcctccacggc
ggccgcccggtgtgcgagtcgctcgccatcctcgagtacatcgacgaggcgtggccggag
aaggcgccgccgctcctccccgccgccgccgacgacccctacggccgcgcgcgggccagg
ttctgggcggactacgtcgacaagaggctcttcgactgccagacccggctgtggaagctc
cgggccggcgaggacggccacgagcaggccaagagggacatggtggatgcgctcagggcg
ctggaggcggagctcggcgaccgggtctacttcggcggcgaggcgttcggctacctcgac
gtcgtgctcgtgccgttcgccgcgtggttccacgcctacgagaggctcggcggcttcgcc
gtggcggagcactgcccgcggctggtggcgtgggccgaacgctgcaaggagagggacagc
gtcgccgcgacgctctctgaccccggcaaggtgtatgagttcgcgctctacctcaaggac
aagtttggcgccaagtaa

DBGET integrated database retrieval system