KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5313Help
Entry
OCAR_5313         CDS       T00783                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00620  Pyruvate metabolism
oca00680  Methane metabolism
oca00710  Carbon fixation in photosynthetic organisms
oca01100  Metabolic pathways
oca01120  Microbial metabolism in diverse environments
oca01200  Carbon metabolism
Module
oca_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCAR_5313 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCAR_5313 (ppc)
   00680 Methane metabolism
    OCAR_5313 (ppc)
Enzymes [BR:oca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OCAR_5313 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PTE
Motif
Other DBs
NCBI-ProteinID: ACI92445
LinkDB All DBs
Position
1298496..1301246
Genome map
AA seq 916 aa AA seqDB search
MPLDMTSERADAQLRAEIRLLGRILGDTVRDHEGTDVFDLVESIRQASIRFHRDEDVSAL
HELEAMLNGRSIAETVRIVRAFSYFSHLANIAEDQNHIRQTRNHSDAGLATAATTLAGTV
DRACDAGFSKEQLRDFFNDALVSPVLTAHPTEVRRKSTIDREMEIAELLADRDRTQMTSE
ELAENDEQLRRCVATLWQTNLLRRTKLTVLDEVQNGLSFYDYTFLKQLPRLINLLEDRLT
PEDDDDDELASFLRMGSWIGGDRDGNPFVTADVLRGTLQMQCERVMNFYIEELQQLYGEL
SLAVPLVKISQELKTLCERSPDVSVHRDREPYRRAVNGIYARLKATARGLDVDTVGRPVD
EVDPYPNVEAFSDDLDIIHRSLVENGSRVIARGRLRRLRRAVDCFGFHLASLDLRQNSAV
HERTIAELFEVAASGTDYLSLSEEERCKLLARELKTVRPLISPFVSYSEETTSELDVLRA
AAEAHAQFGRKVIRQSIVSMAEGISDILEIAVLLKEAGLIDPNGRSHINLVPLFETIEDL
RNCAGIMDRALSLPEYRRLVDSRGGLQEVMLGYSDSNKDGGFVTSGWELYKAEISLVDVF
AKQNVRLRLFHGRGGSVGRGGGPSYEAVLAQPGGAVNGQIRLTEQGEIISSKYSNPEVGR
QNLEILAAATLEASLLQPQHSAPREEYLAAMEELSALAFASYRGLVYETEGFEDYFWAST
VINEISTLNIGSRPSSRSKAKRIENLRAIPWVFSWAQCRLMLPGWYGFGSAVTEWLGKNP
DKGLDFLRELYREWPFFRMLLSNMDMVLSKSSIAVASRYADLVPDKTLRDTIFQRIRAEW
QSSINWLLKIMDQERLLGHNPLLERSIRHRFPYLDPLNHVQVEFLKAHRAKNEDPQVLRG
IQITINGISAGLRNSG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgatatgacctcggagcgggcggacgcgcagttgcgcgccgaaatccgcctg
ctcgggcgcattctgggtgacaccgtccgcgatcatgaaggcaccgatgtcttcgatctc
gtcgaatcgatccgccaggcctcgatccgattccaccgtgacgaggacgtcagtgcgctg
catgaactcgaggccatgctcaacggccgctcgatcgccgagaccgtgcgcatcgtccgc
gccttcagctatttctcgcacctcgccaacatcgccgaggaccagaaccacatccgccag
acccgcaaccacagcgacgcgggactcgcgaccgcggcgacgacgcttgcgggcactgtc
gatcgcgcctgcgacgccggtttctcgaaggagcagttgcgcgacttcttcaacgatgcg
ctggtgagcccggtgctgacggcgcatccgaccgaagtgcgccgcaagagcaccatcgac
cgtgaaatggaaatcgccgaactgctcgcggatcgcgaccgtacgcagatgacgtcggaa
gaactcgccgagaacgacgagcagttgcgccgctgcgtcgccacgctgtggcagaccaac
ctgctgcgccggaccaagctcaccgtgctcgacgaggtgcagaacggcctgtcgttctac
gactacaccttcctcaagcagttgccgcgcctcatcaacctcttggaagaccgcctcacg
cccgaagacgacgatgacgacgagcttgcttccttcctgcggatgggaagctggatcggc
ggcgaccgcgacggcaatccgttcgttactgccgacgtgctgcgcggtacgctgcagatg
cagtgcgagcgggtgatgaatttctatatcgaggaactgcagcagctctacggcgagctg
tcgctcgcggtgccgctggttaaaatctcgcaggagttgaagacgctgtgcgagcgctcg
ccggacgtgtcggtccatcgcgatcgtgagccctatcgccgtgcggtcaacggcatctat
gcgcggctcaaggcgaccgcgcgggggctcgacgtcgacaccgtcggccgccctgtcgac
gaggtcgatccgtatccgaacgttgaagccttcagcgacgatctcgacatcatccatcgc
tcgctcgtggagaatggctcgcgcgtgatcgcgcggggacggctgcgccgtctgcgtcgc
gcggtcgattgcttcggcttccacctcgcgagcctcgatctgcggcagaactccgccgtg
catgagcgcaccatcgcggaactgttcgaggtcgcggcgtcgggcaccgactatctctcg
ctgtcggaagaggagcgctgcaagctgctggcgcgcgaactcaaaaccgtgcggccgctg
atctcgccgttcgtcagctacagcgaggagacgacaagcgaactcgacgtgctgcgcgcc
gccgccgaggcgcatgcgcagttcgggcggaaggtgatccgccagagcatcgtgtcaatg
gcggaaggcatttccgacattctcgaaatcgcggtgctgctcaaggaagccggcctgatc
gacccgaacggccggagtcacatcaatctcgtgccgctgttcgagaccatcgaggatctg
cgcaactgcgcgggcatcatggatcgcgcgctgtcgctgccggaatatcgccgcctggtc
gacagccgcggcggcctgcaggaagtgatgctcggctattccgacagcaacaaggacggc
ggcttcgtcacctccggctgggagctttacaaggccgaaatcagcctcgtcgatgtattc
gccaagcagaacgtgcggctgcggctgttccatggccgcggcggctcggtcggccgcggt
ggcggtccgagctacgaggcggtgctggcgcagccgggcggcgcggtaaacggacagatt
cgcctgaccgaacagggcgaaatcatttcgtcgaaatattccaacccggaagttgggcgg
cagaacctcgaaattctcgccgccgcgacgctcgaagcaagcctgctccagccgcagcac
tctgcgccgcgcgaggaatatcttgcggcgatggaagagctctccgcgcttgccttcgcg
tcctatcgcggcctcgtctacgagaccgaaggtttcgaggattatttctgggcctcgacc
gtcatcaacgaaatctcgacgctcaatatcggcagccgtccatcctcgcgcagcaaggcc
aagcggatcgagaatctccgagcgatcccgtgggtgttctcatgggcgcagtgccggttg
atgctgccgggctggtatggcttcggcagcgccgtcaccgaatggctgggcaagaatccg
gacaagggcctcgacttcctgcgcgaactttatcgcgagtggccgttcttccgcatgctg
ctgtcgaacatggatatggtgctctcgaagagcagcatcgccgtcgcctcgcgctacgcc
gatctggttccggacaagacactgcgcgacaccatcttccagcgcatccgcgccgagtgg
cagagctcgatcaactggctgctgaagatcatggatcaggagcggctgctcgggcacaac
ccgctcttggagcgctcgatccgccaccgtttcccgtatctcgatccgctcaaccacgtg
caggtcgagtttctcaaggcgcaccgcgccaagaacgaggacccgcaggtgctgcgcggc
atccagatcaccatcaacggcatctcggcgggcctgcgcaatagcggttga

DBGET integrated database retrieval system