KEGG   Oceanimonas sp. GK1: GU3_00995Help
Entry
GU3_00995         CDS       T01667                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oce  Oceanimonas sp. GK1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GU3_00995
  Energy metabolism
   00680 Methane metabolism
    GU3_00995
Enzymes [BR:oce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GU3_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
198191..200812
Genome map
AA seq 873 aa AA seqDB search
MDNHAALRANVGLLGQLLGDAIRDHHGQAFLDKIETIRQLAKSARQGNDEDQQRLLTTLK
QLSDDELLPVARAFSQFLNLANVAEQFHTISRGYRQDAGPSPLDQVFERLRTANVGEAAI
REAVAALDIDLVLTAHPTEVTRRTFIHKHVQLNDCLAALELELPEEEKAGLLARVDQLIT
QAWHSNEIRAQRPTPVDEAKWGFAVIENSLWPALPRFLRQLDQRLENELGERLPLDAAPV
RFTSWMGGDRDGNPFVTAKVTEEVLLLGRWMASSLFLADIQELVSELSMSEANTELRAAS
GDSDEPYRAVLRVLREELRETLLHLNARVQGQKTDARDLITQTEQLRQPLELCYRSLQQC
GLGKIADGLLLDVIRKAACFGIHLLKLDIRQDGERHTQALAEITRYLGLGDYAEWSEADK
QAFLLNELNSRRPLLPRQWQPSADTQEVLDTCGVIARHPRDAFGIYIISMAGEPSDVLAV
QLLLKECGVDFPLPVAPLFETLDDLNQGAAVIERLYQLPWYRGYMQGRQYVMIGYSDSAK
DAGMLAAGWAQYSAMEKLVAISARENVTLTLFHGRGGSLGRGGGPARQAILAQPPGSTLG
GLRVTEQGEMIRFKFGLPQVAIDSLALYASAVLEANLLPPPEPEPEWRTLMNSMAEVSCA
HYRSLIRGEPDFVPYFRAATPELELGKLPLGSRPAKRKPDGGVESLRAIPWIFAWTQNRL
MLPAWLGAHKGLEQVMEDGHEATLRAMNKGWPFFRARLDMLEMVFLKADLGLAAYYDSVL
VPEKLKPLGKRLRDELRASTELVLQLKEKSELLSSEPWIQESIKLRNPYTDPLNVLQAEL
LKRSREQGDIHPVLDQALMVTIAGIAAGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggataatcatgcggcactcagggccaatgtcggcctgctggggcagttgctgggcgat
gccattcgggatcatcacggacaggccttcctcgacaaaatagaaaccattcgccagctg
gccaaatcggcccgccagggcaacgacgaagatcagcagcgactgctgaccaccctcaag
cagctgagcgacgacgaactgttgccggtggcccgggccttcagtcagtttcttaacctg
gccaacgtggccgagcagttccataccatttcccggggctaccgtcaggacgccggtccc
agccccctcgatcaggtctttgaacggctcaggactgccaacgtcggcgaggccgccatt
cgcgaggcggtggccgccctcgacatcgatctggtgctcaccgcccaccccacagaggtg
acccgccgcacctttattcacaagcacgtgcagctcaacgactgcctggcggcgctggaa
ctggagctgccggaggaagaaaaggccgggctgctggcccgggtggatcagctgatcacc
caagcctggcacagcaacgagatccgcgcccagcgccccacgccggtggatgaagccaaa
tggggctttgcggtcattgaaaacagcctctggcccgccctgccccggtttctgcgccag
ctcgaccagcgcctggaaaacgagctgggcgaacgcctgcccctggacgcggcgccggtg
cgctttacctcctggatgggcggcgaccgggacggcaacccgttcgtgaccgccaaggtc
accgaagaagtcctgctgctggggcgctggatggccagctcgctgttcctcgccgacatt
caggagctggtctccgagctgtccatgtccgaggccaataccgaactgcgtgccgccagt
ggtgacagcgacgagccctaccgggcggtgctgcgcgtgcttcgggaagaactgcgggaa
accctgctgcacctcaacgcccgagtacagggccagaagaccgacgcccgggatctgatc
actcaaaccgagcaactgcgccagcccctggagctctgttaccgctcgctgcagcaatgc
ggcctgggcaagatcgccgacggcctgctgctggacgtgatccgcaaggcggcctgtttc
ggcattcacctgctcaagctcgacattcgtcaggacggcgagcgccacacccaggccctg
gcggaaatcacccgctacctgggcctgggcgactacgccgaatggagcgaggccgacaag
caggcgtttttgctcaacgagctcaactcccgccgtccgctgctgccccgccagtggcaa
ccgagtgccgacactcaggaggtgctcgacacctgcggcgtgattgcccgtcacccgcgg
gatgcctttggcatctacatcatctccatggccggcgagccgtcggacgtgctggcggtg
caactgctgctgaaggaatgcggggtggatttcccgctgccggtggccccgctgtttgaa
accctggacgatctcaaccagggcgccgcggtgattgagcggctgtatcagctgccctgg
taccgaggctatatgcagggccgccagtacgtgatgatcggttactccgactccgccaag
gacgcgggcatgctggccgccggctgggcccagtacagcgccatggaaaagctggtggcc
atcagcgcacgggaaaacgtcacccttaccctgttccacggtcgcggcggtagcctgggc
cggggcggcggtccggcccgccaggccattctggcccagccgccgggctccaccctcggc
ggcctgcgggtgaccgagcagggcgagatgatccgcttcaagttcggcctgccccaagtg
gccatcgacagcctggcgctctatgccagcgccgtgctcgaggccaacctgttgccgcct
cccgagcccgagcccgaatggcgcacgctgatgaactccatggcggaggtgtcctgcgcc
cattaccgcagcctgatccgcggcgagcccgactttgtgccctacttccgcgccgccacc
ccggagctggagctgggcaagctgcccctgggctcccgcccggccaagcgcaagcccgac
ggcggcgtggaaagcctgcgcgccattccctggatcttcgcctggacccagaaccggctg
atgctgcccgcctggctgggcgcccacaaagggctggaacaggtgatggaagacggccac
gaggccaccctgcgcgccatgaacaagggctggcccttcttccgcgcccgcctcgacatg
ctggaaatggtgttcctcaaggccgacctgggcttggccgcctattacgacagcgtgctg
gtgcccgaaaagctcaagcccctgggcaagcggctgcgggacgagctgcgcgccagcacc
gagctggtgctgcagctgaaggaaaaatcggaactgttgtccagcgagccctggattcag
gagtccatcaagctgcgcaacccctacacggatccgctcaacgtgctgcaggccgagctg
ctcaagcgctcccgggagcagggggacattcacccggtgctggatcaggcgctaatggtc
accatcgccggcatcgccgccggtatgcgtaacacggggtaa

DBGET integrated database retrieval system