KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c26610Help
Entry
OCA5_c26610       CDS       T01617                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase Ppc
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA5_c26610 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCA5_c26610 (ppc)
   00680 Methane metabolism
    OCA5_c26610 (ppc)
Enzymes [BR:ocg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OCA5_c26610 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2823211..2826042)
Genome map
AA seq 943 aa AA seqDB search
MASDVSAFARKPVSGESASQGPETTPDMPLDMTSERADAQLRAEIRLLGRILGDTVRDHE
GTDVFDLVESIRQASIRFHRDEDVSALHELEAMLNGRSIAETVRIVRAFSYFSHLANIAE
DQNHIRQTRNHSDAGLATAATTLAGTVDRACDAGFSKEQLRDFFNDALVSPVLTAHPTEV
RRKSTIDREMEIAELLADRDRTQMTSEELAENDEQLRRCVATLWQTNLLRRTKLTVLDEV
QNGLSFYDYTFLKQLPRLINLLEDRLTPEDDDDDELASFLRMGSWIGGDRDGNPFVTADV
LRGTLQMQCERVMNFYIEELQQLYGELSLAVPLVKISQELKTLCERSPDVSVHRDREPYR
RAVNGIYARLKATARGLDVDTVGRPVDEVDPYPNVEAFSDDLDIIHRSLVENGSRVIARG
RLRRLRRAVDCFGFHLASLDLRQNSAVHERTIAELFEVAASGTDYLSLSEEERCKLLARE
LKTVRPLISPFVSYSEETTSELDVLRAAAEAHAQFGRKVIRQSIVSMAEGISDILEIAVL
LKEAGLIDPNGRSHINLVPLFETIEDLRNCAGIMDRALSLPEYRRLVDSRGGLQEVMLGY
SDSNKDGGFVTSGWELYKAEISLVDVFAKQNVRLRLFHGRGGSVGRGGGPSYEAVLAQPG
GAVNGQIRLTEQGEIISSKYSNPEVGRQNLEILAAATLEASLLQPQHSAPREEYLAAMEE
LSALAFASYRGLVYETEGFEDYFWASTVINEISTLNIGSRPSSRSKAKRIENLRAIPWVF
SWAQCRLMLPGWYGFGSAVTEWLGKNPDKGLDFLRELYREWPFFRMLLSNMDMVLSKSSI
AVASRYADLVPDKTLRDTIFQRIRAEWQSSINWLLKIMDQERLLGHNPLLERSIRHRFPY
LDPLNHVQVEFLKAHRAKNEDPQVLRGIQITINGISAGLRNSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagacgtttcggctttcgcgcgaaagcctgtttccggtgaatcggcctctcaa
ggccctgagacgacccccgacatgcctctcgatatgacctcggagcgggcggacgcgcag
ttgcgcgccgaaatccgcctgctcgggcgcattctgggtgacaccgtccgcgatcatgaa
ggcaccgatgtcttcgatctcgtcgaatcgatccgccaggcctcgatccgattccaccgt
gacgaggacgtcagtgcgctgcatgaactcgaggccatgctcaacggccgctcgatcgcc
gagaccgtgcgcatcgtccgcgccttcagctatttctcgcacctcgccaacatcgccgag
gaccagaaccacatccgccagacccgcaaccacagcgacgcgggactcgcgaccgcggcg
acgacgcttgcgggcactgtcgatcgcgcctgcgacgccggtttctcgaaggagcagttg
cgcgacttcttcaacgatgcgctggtgagcccggtgctgacggcgcatccgaccgaagtg
cgccgcaagagcaccatcgaccgtgaaatggaaatcgccgaactgctcgcggatcgcgac
cgtacgcagatgacgtcggaagaactcgccgagaacgacgagcagttgcgccgctgcgtc
gccacgctgtggcagaccaacctgctgcgccggaccaagctcaccgtgctcgacgaggtg
cagaacggcctgtcgttctacgactacaccttcctcaagcagttgccgcgcctcatcaac
ctcttggaagaccgcctcacgcccgaagacgacgatgacgacgagcttgcttccttcctg
cggatgggaagctggatcggcggcgaccgcgacggcaatccgttcgttactgccgacgtg
ctgcgcggtacgctgcagatgcagtgcgagcgggtgatgaatttctatatcgaggaactg
cagcagctctacggcgagctgtcgctcgcggtgccgctggttaaaatctcgcaggagttg
aagacgctgtgcgagcgctcgccggacgtgtcggtccatcgcgatcgtgagccctatcgc
cgtgcggtcaacggcatctatgcgcggctcaaggcgaccgcgcgggggctcgacgtcgac
accgtcggccgccctgtcgacgaggtcgatccgtatccgaacgttgaagccttcagcgac
gatctcgacatcatccatcgctcgctcgtggagaatggctcgcgcgtgatcgcgcgggga
cggctgcgccgtctgcgtcgcgcggtcgattgcttcggcttccacctcgcgagcctcgat
ctgcggcagaactccgccgtgcatgagcgcaccatcgcggaactgttcgaggtcgcggcg
tcgggcaccgactatctctcgctgtcggaagaggagcgctgcaagctgctggcgcgcgaa
ctcaaaaccgtgcggccgctgatctcgccgttcgtcagctacagcgaggagacgacaagc
gaactcgacgtgctgcgcgccgccgccgaggcgcatgcgcagttcgggcggaaggtgatc
cgccagagcatcgtgtcaatggcggaaggcatttccgacattctcgaaatcgcggtgctg
ctcaaggaagccggcctgatcgacccgaacggccggagtcacatcaatctcgtgccgctg
ttcgagaccatcgaggatctgcgcaactgcgcgggcatcatggatcgcgcgctgtcgctg
ccggaatatcgccgcctggtcgacagccgcggcggcctgcaggaagtgatgctcggctat
tccgacagcaacaaggacggcggcttcgtcacctccggctgggagctttacaaggccgaa
atcagcctcgtcgatgtattcgccaagcagaacgtgcggctgcggctgttccatggccgc
ggcggctcggtcggccgcggtggcggtccgagctacgaggcggtgctggcgcagccgggc
ggcgcggtaaacggacagattcgcctgaccgaacagggcgaaatcatttcgtcgaaatat
tccaacccggaagttgggcggcagaacctcgaaattctcgccgccgcgacgctcgaagca
agcctgctccagccgcagcactctgcgccgcgcgaggaatatcttgcggcgatggaagag
ctctccgcgcttgccttcgcgtcctatcgcggcctcgtctacgagaccgaaggtttcgag
gattatttctgggcctcgaccgtcatcaacgaaatctcgacgctcaatatcggcagccgt
ccatcctcgcgcagcaaggccaagcggatcgagaatctccgagcgatcccgtgggtgttc
tcatgggcgcagtgccggttgatgctgccgggctggtatggcttcggcagcgccgtcacc
gaatggctgggcaagaatccggacaagggcctcgacttcctgcgcgaactttatcgcgag
tggccgttcttccgcatgctgctgtcgaacatggatatggtgctctcgaagagcagcatc
gccgtcgcctcgcgctacgccgatctggttccggacaagacactgcgcgacaccatcttc
cagcgcatccgcgccgagtggcagagctcgatcaactggctgctgaagatcatggatcag
gagcggctgctcgggcacaacccgctcttggagcgctcgatccgccaccgtttcccgtat
ctcgatccgctcaaccacgtgcaggtcgagtttctcaaggcgcaccgcgccaagaacgag
gacccgcaggtgctgcgcggcatccagatcaccatcaacggcatctcggcgggcctgcgc
aatagcggttga

DBGET integrated database retrieval system