Oryctolagus cuniculus (rabbit): 100009313 Help Entry 100009313         CDS       T03373                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04146   Peroxisome ocu04213   Longevity regulating pathway - multiple species ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:ocu00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     100009313 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100009313 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     100009313 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     100009313 (SOD1)    05014 Amyotrophic lateral sclerosis     100009313 (SOD1)    05016 Huntington disease     100009313 (SOD1)    05020 Prion disease     100009313 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     100009313 (SOD1) Enzymes [BR:ocu01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      100009313 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  100009313 NCBI-ProteinID:  NP_001076096 Ensembl:  ENSOCUG00000024552 UniProt:  P09212 LinkDB All DBs Position 14:162758767..162765933 Genome browser AA seq 153 aa AA seqDB search MATKAVCVLKGDGPVEATIHFEQKGTGPVVVKGRITGLTEGLHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDEERHVGDLGNVTAGSNGVADVLIEDSVISLSGDMSVIGRTLVVH EKEDDLGKGGNDESTKTGNAGSRLACGVIGIAP NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggctgtgtgcgtgctgaagggcgacggcccggtcgaggccaccatccac ttcgagcagaagggaacagggcccgtggtggtcaagggacgcataacaggactgaccgaa ggcctgcacggattccatgtccaccagtttggagataatacacaaggctgtacgagtgca ggccctcactttaatcctctatccaaaaaacatgggggaccgaaggatgaagagaggcac gtgggcgacctgggtaatgtgactgcaggcagcaatggtgtggctgatgtgttaattgaa gattctgtgatctcactctcgggagatatgtccgtcattggccgcacgctggtggtccac gagaaagaagacgacttgggcaaaggtggaaatgacgagagtacaaagaccgggaacgcc ggcagtcgtttggcctgtggtgtcattgggatcgccccctaa

DBGET integrated database retrieval system