Oryx dammah (scimitar-horned oryx): 120874649 Help Entry 120874649         CDS       T07255                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01523   Antifolate resistance oda04010   MAPK signaling pathway oda04014   Ras signaling pathway oda04024   cAMP signaling pathway oda04062   Chemokine signaling pathway oda04064   NF-kappa B signaling pathway oda04066   HIF-1 signaling pathway oda04071   Sphingolipid signaling pathway oda04137   Mitophagy - animal oda04151   PI3K-Akt signaling pathway oda04210   Apoptosis oda04211   Longevity regulating pathway oda04218   Cellular senescence oda04380   Osteoclast differentiation oda04613   Neutrophil extracellular trap formation oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04622   RIG-I-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04625   C-type lectin receptor signaling pathway oda04657   IL-17 signaling pathway oda04658   Th1 and Th2 cell differentiation oda04659   Th17 cell differentiation oda04660   T cell receptor signaling pathway oda04662   B cell receptor signaling pathway oda04668   TNF signaling pathway oda04722   Neurotrophin signaling pathway oda04917   Prolactin signaling pathway oda04920   Adipocytokine signaling pathway oda04926   Relaxin signaling pathway oda04931   Insulin resistance oda04932   Non-alcoholic fatty liver disease oda04933   AGE-RAGE signaling pathway in diabetic complications oda04936   Alcoholic liver disease oda05010   Alzheimer disease oda05022   Pathways of neurodegeneration - multiple diseases oda05030   Cocaine addiction oda05132   Salmonella infection oda05133   Pertussis oda05134   Legionellosis oda05135   Yersinia infection oda05140   Leishmaniasis oda05142   Chagas disease oda05145   Toxoplasmosis oda05146   Amoebiasis oda05152   Tuberculosis oda05160   Hepatitis C oda05161   Hepatitis B oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05165   Human papillomavirus infection oda05166   Human T-cell leukemia virus 1 infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05170   Human immunodeficiency virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05200   Pathways in cancer oda05202   Transcriptional misregulation in cancer oda05203   Viral carcinogenesis oda05207   Chemical carcinogenesis - receptor activation oda05208   Chemical carcinogenesis - reactive oxygen species oda05212   Pancreatic cancer oda05215   Prostate cancer oda05220   Chronic myeloid leukemia oda05221   Acute myeloid leukemia oda05222   Small cell lung cancer oda05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oda05321   Inflammatory bowel disease oda05415   Diabetic cardiomyopathy oda05417   Lipid and atherosclerosis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120874649 (RELA)    04014 Ras signaling pathway     120874649 (RELA)    04064 NF-kappa B signaling pathway     120874649 (RELA)    04668 TNF signaling pathway     120874649 (RELA)    04066 HIF-1 signaling pathway     120874649 (RELA)    04071 Sphingolipid signaling pathway     120874649 (RELA)    04024 cAMP signaling pathway     120874649 (RELA)    04151 PI3K-Akt signaling pathway     120874649 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     120874649 (RELA)   09143 Cell growth and death    04210 Apoptosis     120874649 (RELA)    04218 Cellular senescence     120874649 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120874649 (RELA)    04620 Toll-like receptor signaling pathway     120874649 (RELA)    04621 NOD-like receptor signaling pathway     120874649 (RELA)    04622 RIG-I-like receptor signaling pathway     120874649 (RELA)    04623 Cytosolic DNA-sensing pathway     120874649 (RELA)    04625 C-type lectin receptor signaling pathway     120874649 (RELA)    04660 T cell receptor signaling pathway     120874649 (RELA)    04658 Th1 and Th2 cell differentiation     120874649 (RELA)    04659 Th17 cell differentiation     120874649 (RELA)    04657 IL-17 signaling pathway     120874649 (RELA)    04662 B cell receptor signaling pathway     120874649 (RELA)    04062 Chemokine signaling pathway     120874649 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     120874649 (RELA)    04917 Prolactin signaling pathway     120874649 (RELA)    04926 Relaxin signaling pathway     120874649 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120874649 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     120874649 (RELA)   09149 Aging    04211 Longevity regulating pathway     120874649 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120874649 (RELA)    05202 Transcriptional misregulation in cancer     120874649 (RELA)    05207 Chemical carcinogenesis - receptor activation     120874649 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     120874649 (RELA)    05203 Viral carcinogenesis     120874649 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120874649 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     120874649 (RELA)    05221 Acute myeloid leukemia     120874649 (RELA)    05220 Chronic myeloid leukemia     120874649 (RELA)    05215 Prostate cancer     120874649 (RELA)    05222 Small cell lung cancer     120874649 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120874649 (RELA)    05170 Human immunodeficiency virus 1 infection     120874649 (RELA)    05161 Hepatitis B     120874649 (RELA)    05160 Hepatitis C     120874649 (RELA)    05171 Coronavirus disease - COVID-19     120874649 (RELA)    05164 Influenza A     120874649 (RELA)    05162 Measles     120874649 (RELA)    05168 Herpes simplex virus 1 infection     120874649 (RELA)    05163 Human cytomegalovirus infection     120874649 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     120874649 (RELA)    05169 Epstein-Barr virus infection     120874649 (RELA)    05165 Human papillomavirus infection     120874649 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120874649 (RELA)    05135 Yersinia infection     120874649 (RELA)    05133 Pertussis     120874649 (RELA)    05134 Legionellosis     120874649 (RELA)    05152 Tuberculosis     120874649 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     120874649 (RELA)    05145 Toxoplasmosis     120874649 (RELA)    05140 Leishmaniasis     120874649 (RELA)    05142 Chagas disease     120874649 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     120874649 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     120874649 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     120874649 (RELA)   09165 Substance dependence    05030 Cocaine addiction     120874649 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120874649 (RELA)    05418 Fluid shear stress and atherosclerosis     120874649 (RELA)    05415 Diabetic cardiomyopathy     120874649 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120874649 (RELA)    04932 Non-alcoholic fatty liver disease     120874649 (RELA)    04931 Insulin resistance     120874649 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     120874649 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120874649 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oda03000]     120874649 (RELA) Transcription factors [BR:oda03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     120874649 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  120874649 NCBI-ProteinID:  XP_040112158 LinkDB All DBs Position Unknown AA seq 557 aa AA seqDB search MDDFFPIIFSEEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASVPKPAPQPYSFTPSLSTINF EEFSPMVFPSGQIPSQTSALAPAPTPVLTQTPVLAPVPAPAPAPAPAPGMASTLAQALAP GLAQAVTPPAPKTNQPGEGTLAEALLHLQFDTDEDLGALLGNSTDPAVFTDLASVDNSEF QQLLNQGVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDF SSIADMDFSALLSQISS NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt atggacgacttcttccccatcatcttctccgaagagcctgcgcaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcagccggcagcatccctggcgagaggagcacagacaccaccaagactcaccccact atcaagatcaatggctacacggggccagggacagtccgcatctccctggtcaccaaggac cctcctcaccggcctcacccccacgagctagtggggaaagactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt gtaaagaagcgggacttggagcaggccatcagccagcgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgcggggactacgacctgaatgccgtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctggcgcctgtcctctct catcccatctttgacaaccgcgcccccaacaccgccgagctcaagatctgccgggtaaat cggaactctgggagctgcctcggcggggacgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaggtgtatttcacgggaccgggctgggaggctcgaggctctttttca caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctatgcagacccc agcctgcaggcccctgtgcgcgtttccatgcagctgcggcggccttccgatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag aagcgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagccctttcaatgga cccaccgacccccggcctccaacccggcgcatcgctgtgcctaatcgcggctcagcctcc gtccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt gaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggccttg gcaccagcccccaccccggtcctgacccagaccccagtcctggccccggtcccagcccca gccccagccccagccccagccccaggcatggcatcaaccctggcccaggccctagcccca ggcctggctcaggctgtgaccccgcctgcccccaagaccaaccagcccggggaagggaca ctggcagaggccctgctgcatctgcagtttgataccgatgaagacctgggggctctgctc ggcaacagcactgaccctgccgtgttcacagacctggcatctgtcgacaactctgagttt cagcagttgctgaaccagggtgtacccatgggcccccacacagctgagcccatgctgatg gagtaccctgaggctataactcgcctggtgacagggtcccagaggccccctgacccagct cccactcccctggggccccctgggctcaccaatggcctcctctcgggggatgaagacttc tcctccatcgcggacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system