Oncorhynchus gorbuscha (pink salmon): 124037328 Help Entry 124037328         CDS       T07892                                  Name (RefSeq) metallothionein B   KO K14739   metallothionein 1/2 Organism ogo  Oncorhynchus gorbuscha (pink salmon) Brite KEGG Orthology (KO) [BR:ogo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ogo03019]     124037328    03029 Mitochondrial biogenesis [BR:ogo03029]     124037328 Messenger RNA biogenesis [BR:ogo03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      124037328 Mitochondrial biogenesis [BR:ogo03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     124037328 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  124037328 NCBI-ProteinID:  XP_046208000 LinkDB All DBs Position LG01:38824508..38825680 Genome browser AA seq 60 aa AA seqDB search MDPCECSKTGSCNCGGSCKCSNCACTSCKKSCCPCCPSDCSKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgtgaatgctctaaaactggctcttgcaactgcggtggatcctgcaagtgc tcaaactgcgcatgcaccagttgtaagaaaagttgctgcccctgctgtccttccgactgc agtaaatgtgcttcaggctgtgtgtgcaagggcaagacctgtgacaccagctgttgtcag tga

DBGET integrated database retrieval system