Oncorhynchus kisutch (coho salmon): 109889513 Help Entry 109889513         CDS       T09179                                  Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04012   ErbB signaling pathway oki04068   FoxO signaling pathway oki04137   Mitophagy - animal oki04140   Autophagy - animal oki04150   mTOR signaling pathway oki04210   Apoptosis oki04218   Cellular senescence oki04370   VEGF signaling pathway oki04371   Apelin signaling pathway oki04540   Gap junction oki04625   C-type lectin receptor signaling pathway oki04810   Regulation of actin cytoskeleton oki04910   Insulin signaling pathway oki04912   GnRH signaling pathway oki04914   Progesterone-mediated oocyte maturation oki04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109889513    04012 ErbB signaling pathway     109889513    04370 VEGF signaling pathway     109889513    04371 Apelin signaling pathway     109889513    04068 FoxO signaling pathway     109889513    04150 mTOR signaling pathway     109889513  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109889513    04137 Mitophagy - animal     109889513   09143 Cell growth and death    04210 Apoptosis     109889513    04218 Cellular senescence     109889513   09144 Cellular community - eukaryotes    04540 Gap junction     109889513   09142 Cell motility    04810 Regulation of actin cytoskeleton     109889513  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109889513   09152 Endocrine system    04910 Insulin signaling pathway     109889513    04912 GnRH signaling pathway     109889513    04914 Progesterone-mediated oocyte maturation     109889513    04916 Melanogenesis     109889513  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oki04131]     109889513   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oki04031]     109889513 Membrane trafficking [BR:oki04131]  Endocytosis   Macropinocytosis    Ras GTPases     109889513 GTP-binding proteins [BR:oki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109889513 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  109889513 NCBI-ProteinID:  XP_020336570 Ensembl:  ENSOKIG00005005761 LinkDB All DBs Position LG4:complement(39929196..39945706) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaagctggtggtggtgggggcaggaggtgtgggcaagagcgcgctcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatcgaggactcatac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaacacaaagtcctttgaggacatccaccactatagagagcagatc aagcgggtgaaagactcggaagacgtgcccatggtgctggtgggaaacaagtgtgacctg ccgtcccggacggtggacaccaaacaagctcaggacttggcgcgcagctacggcatcccc ttcatcgagacctcggccaaaaccagacagagagtggaggatgccttttacagtctggta cgggagatcagactgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system