KEGG   Oryzias latipes (Japanese medaka): 101156878Help
Entry
101156878         CDS       T02443                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00010  Glycolysis / Gluconeogenesis
ola00051  Fructose and mannose metabolism
ola00052  Galactose metabolism
ola00500  Starch and sucrose metabolism
ola00520  Amino sugar and nucleotide sugar metabolism
ola00524  Neomycin, kanamycin and gentamicin biosynthesis
ola01100  Metabolic pathways
ola01200  Carbon metabolism
ola04910  Insulin signaling pathway
Module
ola_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ola_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101156878
   00051 Fructose and mannose metabolism
    101156878
   00052 Galactose metabolism
    101156878
   00500 Starch and sucrose metabolism
    101156878
   00520 Amino sugar and nucleotide sugar metabolism
    101156878
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101156878
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101156878
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101156878
Membrane trafficking [BR:ola04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101156878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101156878
NCBI-ProteinID: XP_004067292
UniProt: H2M3R1
LinkDB All DBs
Position
3
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDITNRFRMELVKGLGRDTNATAS
LKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIFDTPEDIIH
GTGTQLFDHVAECLGTFMEKHNIKDKKLPVGFTFSFPCQQAKLDEGYLITWTKSFKASGV
EGMDVVNLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAREGLLFEGQITPEMLTKGKFETKHVSAIEKSKEGLTKARDVLSKLG
VEPSADDCVAVQHICSIVSHRSANLVAAVLAGILMRLKENKGVGRLRTTVGIDGSLYKMH
PQYSRRLHKTVRRLVPDCDVRFLLSNSGSGKGAAMVTAVAYRLAEQSKQIVQILSEFRLT
TEQLLEVKNRMRVEIQNGLSKRTHDSATVKMLPTFVQSTPNGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRSVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGF
TFSFPCKQTSLDAGTLVTWTKGFKATDCEGEDVVGLLREAIKRREEFELDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNVEMVDGDEGQMCVNMEWGAFGDNGCLDD
MRTEYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGIVSRRAAQLCGAGMAA
VVDKIRENRGVDHLNITVGVDGTLYKLHPHFSGIMHQTVNELAPKCSVNFLLSEDGSGKG
AALITAVGCRQRQEQNSK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccagctattagcctactacttcacggagctgaaggatgaccaggttaaa
aaaattgataagtacttgtactccatgcgcttctctgacgagacgctgctggacatcacg
aaccgcttcagaatggagctggtcaaaggattgggccgggacactaatgccactgcttcg
ctcaagatgctcccaacatttgtgcgctcaatccctgacggatcagagaaaggagacttc
attgctttagatttaggaggcagttacttccggatccttcgggtcaaagtcagccacgag
aagaaacagacggttcagatggagagcgaaatcttcgacacgccagaggacatcatccac
ggcacaggaacacaactgttcgaccatgttgcagagtgtctaggcaccttcatggaaaaa
cacaacatcaaagacaagaaactccccgtggggtttaccttctcctttccctgccagcag
gctaaacttgatgagggctacctgataacatggaccaagagcttcaaggccagtggggtg
gaaggaatggacgtggtcaacctgctcaacaaagcgatcaagaaacgaggagactatgaa
gcagacatcatggcagtagtgaacgacacggtgggaaccatgatgacctgcggttttgat
gaccagcgctgtgaagtgggcatcatcataggcacaggcaccaatgcttgctacatggag
gagctgcgccacattgacctggtggagggagacgagggcaggatgtgtgtgaacacagaa
tggggggcgtttggagatgacggcaggctggaggacatccgaacagagtttgacagagag
atagacagaggatctctcaatccaggcaaacagctatttgagaagatggtcagtggtttg
tacatgggcgagctggtgcgtctcatcctggtgaagatggccagggaaggcctcctgttt
gagggacagatcaccccagagatgctcacaaagggcaagtttgagaccaagcatgtctct
gccattgagaagagtaaagaagggctgaccaaagccagggatgttctgagcaaacttggg
gtggagccctcagcagatgactgtgttgctgtgcagcatatttgttctattgtgtctcat
cgctctgctaacctggttgctgctgtccttgctggcatcttgatgaggctgaaggagaac
aagggagtgggacggctcagaaccacagtgggcattgacggctctctgtacaaaatgcat
ccacaatattcccgtcgccttcataaaacagtccggcgtttggttcccgactgtgacgtc
cgcttcctcctgtccaacagcggcagtgggaagggcgccgccatggtcacagctgttgcc
tacagactggcagaacagtccaaacaaattgttcaaatactgtctgagttccgtcttaca
accgagcagctgctggaggtgaagaacagaatgagggtggagatacaaaatggcctctca
aagaggacccatgattctgccactgtcaaaatgcttccaacctttgtgcagagcacgcct
aatgggacagaacacggggatttcttggctttggacttgggtgggaccaactttagggtc
ctcttagtcaaaattcgctctgggaagaaaagatctgtggagatgcacaacaagatctat
gccatccctttagaagtgatgcaaggaacaggagaggagttgttcgaccacattgtgcac
tgtatcagtgacttcctggactacatggggatgaagaacgctcgtcttcctcttggcttc
accttctctttcccttgcaaacagacgagtctggatgctggcaccttggtgacatggacc
aaaggcttcaaggcaacagactgtgaaggagaggatgttgtgggactgctaagggaggca
ataaagcggcgagaggagtttgaactggacgtggtagctatagtgaacgacactgttggc
accatgatgacctgtgcctatgaagaacccacctgtgaggttggactcattgcaggcacc
ggcagtaatgcgtgctacatggaagagatgaggaacgttgagatggtggacggggacgaa
ggacagatgtgcgtcaacatggaatggggagcatttggggacaacgggtgtctggatgac
atgaggactgaatatgaccgagctgtggatgacctctcgcttaatccaggcaaacagaga
tatgaaaaaatgtgcagtggcatgtaccttggtgaaattgtgcgaaacatcctcatagac
atgaccaagaaaggattcttgttcagaggacagatttctgaaaccctgaagaccagaggc
atcttcgaaacaaagttcctctcacaaatagaaagtgaccggttggctttgctgcaggtg
agatccattctgcagcatctggggctggacagcacttgtgatgacagtattatcgtcaaa
gaggtatgtggaattgtgtcacggcgggcggctcagctgtgtggcgcaggaatggcggcc
gttgtcgataagattagagagaaccgtggagtggaccatctcaacatcacagtaggggtg
gacgggactctctacaaattacatccacacttttccgggatcatgcaccagactgttaat
gagctggctccaaagtgtagcgtcaacttcctgctgtcggaggacgggagcgggaaggga
gcggcgctaatcacagctgtaggctgccggcaaaggcaggagcagaacagtaaatag

DBGET integrated database retrieval system