KEGG   Oryzias latipes (Japanese medaka): 101169793Help
Entry
101169793         CDS       T02443                                 

Gene name
kmt5a
Definition
(RefSeq) N-lysine methyltransferase KMT5A isoform X1
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101169793 (kmt5a)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101169793 (kmt5a)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101169793 (kmt5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
12
AA seq 331 aa AA seqDB search
MNGEVVCTTTSFLRCSKSASAVQNDKPAGIRLTQEGRRSPICSQQSDAPRPAEGRTADAN
GATPQHSKAELPDTHSSYSQCSPCWQDEQPPPPQLHRTQASLWPPPEAPRLLSKSLSPAP
LHSNNGEALRAQHRRGGVGKARKCSRRTRMEGKNSQNRKVTDYYPIRRSSRKSKTELKCE
RKKLIDELIIKGIEEGMEVQYMEGKGRAVFATQCFQKGDYVVEYHGDLLHITDAKKREAE
YAENPATGCYMYYFQYLCKTYCVDATRETGRMGRLINHSKNGNCQTKLHDINGTPHLILV
ASRDIDKGEELLYDYGDRSKASIAAHPWLKY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggaagtcgtctgcaccaccacctccttcctaagatgctccaagtcggcgtca
gcggttcagaacgacaaacctgctggcatccggctgacgcaggagggccggcgctccccc
atctgctcccagcagagcgacgcccccaggccggctgagggcagaacagcggacgccaac
ggcgccacgccacaacactcgaaggcggagcttcccgacacccacagcagctacagccag
tgctccccatgctggcaagatgagcagccgcctcccccgcagctccaccgcactcaggcg
tccctctggcctccccccgaggccccccgactcctctccaaaagcttgtctccggctccg
ctccacagcaacaacggcgaggcgctccgagcccagcacaggagagggggcgtcggcaag
gcgaggaaatgctcgcggcgaaccaggatggaaggaaaaaactcccaaaaccgaaaggtg
accgactattatccaatcagacggagctcgaggaaaagcaaaacggagctaaagtgtgaa
cggaagaagctcattgatgaactcatcattaaaggaattgaggaaggaatggaggtgcag
tacatggaaggaaaggggagggccgtgttcgccacgcagtgcttccagaaaggcgactac
gtggtggagtaccacggtgacctgctgcatatcaccgatgcaaagaagagggaggccgaa
tacgccgaaaaccccgccaccggctgctacatgtactacttccagtacctctgcaaaaca
tactgcgtggacgccaccagagagacgggccggatgggtcgcctgatcaaccacagcaaa
aacgggaactgccaaaccaaactccacgacatcaacggcaccccgcacctcattctcgtg
gcctcgcgggacatcgacaagggggaggagctgctgtacgattacggcgaccgcagcaaa
gcgtccatcgccgcccacccgtggctcaaatactga

DBGET integrated database retrieval system