KEGG   Oryzias latipes (Japanese medaka): 101172772Help
Entry
101172772         CDS       T02443                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101172772 (ace)
Peptidases [BR:ola01002]
 Metallo Peptidases
  Family M2
   101172772 (ace)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101172772 (ace)
CD molecules [BR:ola04090]
 Proteins
  101172772 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
19
AA seq 1282 aa AA seqDB search
MAVGPVRLLWSVLLLLPVLGLSEALPADWLPGEYVNTISDAQRFLSDYNSTAEEVFYFSV
SASWNYNTNLTDHNSKLQVAASLEEQAFIEAWGLKAKTVFTDEVLNTLPDPKDKKLMEKI
KSLGAANLPQAEREKYNTILSTMDSIYSTAKVYPQPNVSWSLEPELTDIMATSRSYKKLL
FAWDGWHNASGVPLKKLYPEFVELSNKASQADGFADTGADWRSWYESETFEQDIDNLYKT
IEPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPNKPNL
DVTDEMVRQGYNATHMFRVSEEFFTSLGLLEMPTEFWEGSMIVKPDDREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLS
VSTPKHLHTINLLESAASDTETDINYLLKMALEKIAFLPFGYLIDLWRWGVFNGRTPPEK
YNSEWWYLRTKFQGICPPTKRSEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEA
AKHTGPLHTCDIYRSAEAGEILRKVLQAGSSKPWPEVLQEAIGTREMNANSLLKYFEPVI
KWLEEQNVNETLGWPDFGWVPPVPEGYPEDIEKNTDELDAKRLLDEYNTTAEEVWNAYTE
ASWKYNTDITDANKQAMLNRSLEMSAHTLKYGLKAREYDTTDFQDPLVKRVIAKLSDIER
AALPPEELEEYNTLLSNMETKYSVAEVCREDGRCHPLDPDLQKIMAESRDYNELLFAWKG
WRDAAGKVLRQDYERYVELANKAAVLDGYSDNGAMWRSLYETPTFEEDLESLWMELQPLY
QNVHAYVRRALYKKYGPQHINLKGPIPAHLLGNMWAQTWSGIMDFAIPYPGATQVDATPA
MLAQGWNATRMFQESDRFFTSLGLLPMPEEFWEKSMLEKPSDGRQVVCHASAWDFYNRKD
FRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTP
KHLKSIGLLDKVEENYESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPNEYNKE
WWNLRLKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHN
GPLHTCDIYQSKEAGKLLSDVMKLGSSKPWPEAMAIITGQSKMSAQPLMQYFEPLIQWLQ
RENQMNGDVIGWPEYDWIPQEKFEVANKVEFLGLYLYESSASTGSWVLLGVALIFAVTTI
VFVYKYKKAKKYRKSSSTLELK
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcggcccggtcaggttgctatggtcagtgctgctgctgctgccagttttgggg
ctctctgaagctcttccagccgactggcttccaggagaatatgtaaacaccatctctgac
gcccagaggtttctgagtgattacaacagcaccgccgaagaggtgttttacttcagtgtg
tctgccagctggaactacaacaccaacttaacagaccacaactccaagcttcaggttgca
gcctcccttgaagagcaagccttcattgaagcctgggggttgaaggccaagactgtcttc
actgacgaggttctcaacacgctccctgaccctaaagacaaaaagctgatggaaaagatc
aagtcattgggtgctgccaaccttccccaggcagaacgagagaagtataacaccattctc
agcactatggacagtatttattccacagctaaggtttacccacagccaaatgtaagctgg
agtctggagcctgagctcactgacatcatggccacctctagaagctacaagaagctgctg
tttgcttgggacggttggcacaatgcgtcaggtgttcctctcaaaaagctctatccagag
tttgtggagcttagcaacaaagcttctcaagctgatggatttgcagacactggagctgac
tggcgatcctggtatgagagtgaaacctttgagcaagacattgacaacctttataaaacc
attgagccactctatctgcacctgcacgcctttgtgcgccgcaagctctacaaccaatat
ggttccaagtacatcaacctgaaaggaccaatccctgcacacctgttgggaaacatgtgg
gctcaaacatggaacaacatttacgatctgatgatcccatttcccaacaaacccaacctg
gatgtgactgatgaaatggtcagacaaggctacaatgctacacacatgtttcgagtgtca
gaggagttcttcacctccctagggttgctggaaatgccaacagaattctgggaaggatcc
atgattgtcaaacctgatgatcgagaagttgtgtgtcacgcatcagcctgggacttctac
aaccgcaaagacttcagaattaaacagtgcactacagtgacaatggaacagcttttcact
gtacaccatgaaatggggcacatccagtactacctacagtacaaggaccagccagttggg
tttcggaggggtgctaaccctggttttcatgaagccattggggatgttttgtccctttct
gtttcaacaccaaagcatctgcacacgattaacctgctggagtctgcagcctccgataca
gaaactgacatcaactacctgctgaagatggcgctagaaaaaattgcatttcttcctttt
ggctacctcattgacctctggagatggggtgtttttaatggaagaactcctccagagaag
tacaattctgagtggtggtacctcagaacaaaatttcagggaatttgtccgccaaccaaa
cgatcagaggagcattttgatcctggggcaaagtaccacattcccggaaacacgccatac
atcaggtattttgtcagcttcatccttcagttccaattccatgagaaactgtgcgaggca
gccaaacacacaggtcctttgcatacatgtgacatctaccgctctgcagaagcgggagag
attttgaggaaagtccttcaagctggttcctccaaaccgtggcctgaagtccttcaggag
gccataggcaccagggagatgaatgccaactcattgttgaaatactttgaacctgttatt
aagtggctggaagaacaaaacgtaaatgagaccctgggatggcctgactttggctgggtc
ccacctgtccctgaaggataccctgaagatattgaaaagaatacagatgagcttgatgct
aaaagacttctagatgagtataataccacagctgaggaggtgtggaacgcatacactgaa
gccagctggaaatacaacacagacatcaccgacgccaataaacaggcgatgctcaacaga
agcctggagatgtcagcacacactctaaaatatggtctgaaggctcgagagtacgacacc
accgacttccaggatcccttggtcaaacgcgtcattgctaaactcagtgacatcgaaagg
gctgcacttcctccggaagaattggaagagtacaacactcttctgtccaacatggagact
aaatacagtgtggctgaggtttgccgagaagatgggagatgccatccactagaccctgac
ctccagaagatcatggcagagtccagggattacaatgagctattgtttgcctggaaggga
tggagagatgctgctggcaaagtacttcgtcaggattatgagagatacgttgagctggcc
aacaaagcggctgtgcttgatggttattctgataatggggctatgtggcggtctctgtat
gaaaccccgacctttgaggaagacctggagtccctgtggatggagctgcagccgctctac
cagaatgttcatgcctacgttcgaagggctctgtacaaaaagtacggtccccagcacatc
aacctaaagggacccatccctgcacatttgctgggtaacatgtgggcacagacatggtct
ggaataatggattttgccataccgtaccctggtgccactcaagttgatgctacgccagct
atgttagcacagggctggaatgcaaccaggatgtttcaggaatcagaccgtttttttacg
tctcttggactgctgccaatgccagaggaattctgggaaaaatctatgctagagaagcca
tcagatggacggcaggtggtgtgccacgcctctgcttgggacttctataaccgaaaagac
ttcaggataaaacaatgcaccgttgtgaccatggatgacctgatcacagtgcaccacgaa
atgggacacgtgcaatactttcttcagtacaaagaccagccagtgtccttccgtgatgga
gccaacccaggtttccatgaggccattggtgatgtcctcgccctgtcagtgtccacaccc
aaacatttgaagagcatcggcctcttggacaaagttgaagaaaactatgaaagtgacatc
aactttctcatgagcatggcacttgacaagattgccttcctgccttttggctacctcatg
gatcagtggaggtggaaggtgtttgatggtcgaatcccaccgaatgagtataacaaggag
tggtggaacctcagattgaagtatcagggactgtgtccacctgtggctcgtactgaggag
gactttgacccgggtgcaaagttccacattcctgcaaatgtgccctacgtcaggtacttt
gtgagtttcatcatccagtttcagttccacaaagctttatgtgaagccgcaaatcacaat
gggcctctgcatacctgtgatatctaccaatccaaagaggctggaaagctgttgagtgat
gtgatgaagctaggctctagtaagccgtggcctgaagccatggcgatcatcaccggtcag
tccaaaatgagcgcccagcctctaatgcagtattttgagcctctcatacaatggctgcag
cgagagaaccagatgaacggtgatgttattggatggcctgagtacgactggatacctcaa
gaaaaatttgaagtggccaataaagtggaattccttggcctgtacctctacgagtcatct
gcttcaacgggcagttgggtccttctgggcgttgccctgatcttcgcggtgaccaccatc
gtgtttgtgtacaaatacaaaaaggcaaagaagtatagaaagtcctcgtctactttggaa
ctgaagtaa

DBGET integrated database retrieval system