KEGG   Oscillatoria nigro-viridis: Osc7112_5805Help
Entry
Osc7112_5805      CDS       T02375                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00630  Glyoxylate and dicarboxylate metabolism
oni00710  Carbon fixation in photosynthetic organisms
oni01100  Metabolic pathways
oni01120  Microbial metabolism in diverse environments
oni01200  Carbon metabolism
Module
oni_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oni_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
oni_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Osc7112_5805
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Osc7112_5805
Enzymes [BR:oni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Osc7112_5805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ10013
UniProt: K9VPK3
LinkDB All DBs
Position
6953565..6953900
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDAQIAKQLQYILDQGYIPGVEFSESSAAEMHYWTLWKLPL
FGAKSLPEIMTEIQACRQEYPQCYIRVMGFDNVKQCQVLSFIVHKPNTRGY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttacctaaagagcgccgttacgaaactctgtcttatttgcccccgctgaca
gacgcgcaaattgccaagcaactccagtacatcctggatcaaggctacattcccggcgta
gaattcagcgaaagctctgccgctgaaatgcactattggactctgtggaagttgcctttg
tttggtgcaaaatcactgccggaaatcatgacagaaattcaagcttgccgtcaagaatac
ccccagtgctacatccgcgtcatgggttttgacaacgtgaagcagtgccaagtgctcagc
ttcatcgtccacaagcctaacaccagaggctactaa

DBGET integrated database retrieval system