KEGG   Oenococcus oeni: OEOE_0387Help
Entry
OEOE_0387         CDS       T00408                                 

Definition
(GenBank) aminotransferase
  KO
K20708  
isoleucine 2-epimerase [EC:5.1.1.21]
Organism
ooe  Oenococcus oeni
Brite
Enzymes [BR:ooe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.21  isoleucine 2-epimerase
     OEOE_0387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(376523..377875)
Genome map
AA seq 450 aa AA seqDB search
MNNLEKASRLIDEENNYYARSARINYYDLVINHAHGATLIDVDGNEYIDLLASASAINVG
HTNERVVKAISRQAQKLIHYTPAYFHHVPGIELSKRLAELAPGNSPKMVSFGNSGSDAND
AIIKFSRAYTSRQYIVSYMGSYHGSNYGSQSLSGTSLNMTRKIGPMLPGVVHVPYPDLYR
RYAGETEHDVAIRYFNAFKAPFESFLPADETACVLVEPIQGDGGIVKAPEEYMQLVYKFC
HDNGILFAVDEVNQGLGRTGKMWGIQQYKDIEPDLMSVGKSLASGMPLSAVVGKKDIMQS
LDAPAHIFTTSGNPVCAAASLATLNVIRDDHLVEKSAKDGEYAKQRFLEMQRHHPIIGDV
RMWGLNGGIELVKDPKTKEAENDAATKVIYYAFAHGVVIITLAGNILRFQPPLVISHKQL
DKALQVLDDAFTAVEQNKVEVPKDTGKIGW
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttagagaaggcatctcgattaatcgacgaagaaaacaattattatgcacgt
tcggcacggatcaattactatgacctggtgatcaaccatgctcatggggcaacgctgatc
gatgtcgatggcaacgaatatatcgatcttttggcaagcgcttcagcaattaatgtcggg
catacaaacgaacgggttgtcaaggcaataagcaggcaggcacaaaagttgattcattat
acgccggcttattttcaccacgtaccaggaattgaattatcaaaacgtttagccgaactc
gctcctggcaattcacccaaaatggtcagttttggtaattccggttctgatgccaacgat
gcaattataaaattttctcgtgcgtacaccagccgccaatatattgtttcttatatggga
tcctaccatggttcaaactatggttcgcaaagcctgtcaggaaccagtttgaacatgact
cgaaaaatcggtccaatgcttccaggcgttgtccacgttccctatccggatctttatcgt
cgttacgcaggtgagactgagcacgacgttgctatacgttacttcaatgctttcaaggca
ccattcgaatcatttttgcctgccgatgaaaccgcctgtgtcttagttgaaccaatccaa
ggcgatggtggaattgttaaggctccggaagaatatatgcaactggtttataaattctgt
catgataatggcattttatttgctgttgacgaggttaaccaagggcttggccgaacgggc
aaaatgtggggaattcaacaatataaagatattgaaccggacttaatgtcggtcggaaaa
tcactggcttctggaatgccgcttagcgctgttgtcggtaaaaaagatatcatgcagagc
cttgacgcaccggcccatatctttactacttctggcaatccggtatgcgctgctgcatca
ctagccaccttgaatgttattcgagacgatcatctagttgaaaagtcagctaaagacgga
gaatatgcaaaacaacgttttcttgagatgcaaagacatcacccgataatcggcgacgtt
cgcatgtggggactaaacggtggaattgaattagttaaagatcctaaaactaaagaagca
gagaatgacgcagcaacaaaagttatctactatgcctttgcacatggtgtcgtcattatt
acccttgcaggaaatattttaaggtttcaaccgcccttggtcatatcccacaaacagttg
gataaggcgctgcaggtgcttgatgatgcatttacagctgttgaacaaaataaagtcgaa
gtaccaaaagacacgggaaaaattggttggtaa

DBGET integrated database retrieval system