Orcinus orca (killer whale): 101273794 Help Entry 101273794         CDS       T05247                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism oor  Orcinus orca (killer whale) Pathway oor04010   MAPK signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04020   Calcium signaling pathway oor04151   PI3K-Akt signaling pathway oor04810   Regulation of actin cytoskeleton oor05200   Pathways in cancer oor05207   Chemical carcinogenesis - receptor activation oor05218   Melanoma oor05224   Breast cancer oor05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101273794 (FGF4)    04014 Ras signaling pathway     101273794 (FGF4)    04015 Rap1 signaling pathway     101273794 (FGF4)    04020 Calcium signaling pathway     101273794 (FGF4)    04151 PI3K-Akt signaling pathway     101273794 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101273794 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101273794 (FGF4)    05207 Chemical carcinogenesis - receptor activation     101273794 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     101273794 (FGF4)    05218 Melanoma     101273794 (FGF4)    05224 Breast cancer     101273794 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101273794 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101273794 (FGF4) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Growth factors (RTK binding)    101273794 (FGF4) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Growth factors/receptors    101273794 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  101273794 NCBI-ProteinID:  XP_004278097 LinkDB All DBs Position 8:3763077..3764844 Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLAAVLLAVLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVAGRFFVAMSSRGKLYGSPFFTDECKFKEILLPNNYNAYECYRYPGMFIA LSKNGKTKKGNRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcagcgctgctcgcggcggtgctgctggccgtgctg gcgccctgggccggccgagggggcgccgccgcgcccaccgcacccaacggcacgttggag gccgagctggagcgtcgctgggagagcctggtggcgcgctcgctggcgcgcctgccggtg gccgcgcagcccaaggaggctgccgtccagagcggcgccggggactacctgctgggcatc aagaggctgcggaggctctactgcaacgtgggcatcggcttccacctccaggtgctccca gacggccgcatcggcggcgtgcacgcggacacgagtgacagcctgctggagctctcgccc gtagagcggggagtggtgagcatcttcggcgtggccggccggttcttcgtggccatgagc agcagaggcaaactctacggctcgcctttcttcaccgatgagtgcaagttcaaggagata ctcctccccaacaactacaacgcctacgagtgctacaggtaccccggcatgttcatcgcc ctgagtaagaacgggaagaccaagaaggggaaccgggtgtcacccaccatgaaggtcacc catttcctccccaggctgtga

DBGET integrated database retrieval system