Ochotona princeps (American pika): 101531412 Help Entry 101531412         CDS       T07609                                  Name (RefSeq) centrin-4-like   KO K25390   centrin-4 Organism opi  Ochotona princeps (American pika) Brite KEGG Orthology (KO) [BR:opi00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:opi03037]     101531412 Cilium and associated proteins [BR:opi03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    101531412 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 AIF-1 EF-hand_8 EF-hand_9 EF-hand_4 HerA_C EF-hand_5 Motif Other DBs NCBI-GeneID:  101531412 NCBI-ProteinID:  XP_004599836 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search ASSCGTSSDLRNKRAEKIELNEIQKQEIKEVFDLFDVNESGTMDLKQLKVAMQALGFEPT KEEIKEMIAEVDKGGLGTITFEDFFAFMSIKM NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gcatccagctgtggcacaagttcagacttacggaataaaagagcagaaaaaattgaactg aatgaaattcaaaagcaagagattaaagaggtctttgatctattcgatgtcaatgagtct ggcaccatggatctgaaacaactgaaggttgcaatgcaggccttaggatttgaaccaaca aaagaagaaattaaagaaatgatagctgaggtcgacaaaggaggacttggcaccattact tttgaagacttttttgcttttatgagtataaaaatg

DBGET integrated database retrieval system