KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328326Help
Entry
4328326           CDS       T01015                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4328326
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328326
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4328326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 234 aa AA seqDB search
MPMPLPSQVHRCHLLPAPPHSPSLVTLLYSPLLNLFTPPPATTTTLYSGDIMFINTASFV
AGAVVASPEQPAKLVRDQRRVVPGSCRARRGAASNGFRTYCMQTWNPFTNRRYEAMSYLP
PLSAKSISKEIEFIMSKGWVPCLEFDKEGEIHRSNSRMPGYYDGRYWTLWKLPMFGCSDA
AAVLREVEECRREYPDAFIRLIAFDSSRQCQCMSFVVHKPPSAAASPATVAGAE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgccattgccatcccaagtgcaccggtgccaccttctcccagcgccaccacac
tctccatctcttgtcaccttgctctactctccccttcttaacctcttcacgccaccgccg
gccaccaccaccactctctactccggcgacatcatgttcatcaacacggccagcttcgtc
gccggcgccgtcgtcgcttcgccggagcagccggccaagcttgtccgggatcagaggagg
gtggtgcctggctcctgcagggcaagaagaggtgcagcatccaatggcttcagaacttac
tgcatgcagacatggaaccctttcaccaacaggaggtacgaggcgatgtcttacctgcct
cccctgagcgcgaagtccatctccaaggagatcgagttcatcatgtccaaaggatgggtc
ccttgcctcgagtttgacaaggagggggagatccaccggagcaacagccggatgccgggg
tactacgacgggaggtactggacgctgtggaagctgccgatgttcggatgctctgacgcg
gcggcggtgctccgggaggtggaggaatgccggagggagtacccggacgccttcatccgc
ctcatcgccttcgacagcagccgccagtgccagtgcatgtccttcgtcgtccacaagccg
ccgtcggccgccgcttctccggccacggtcgccggagctgaatga

DBGET integrated database retrieval system