KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344210Help
Entry
4344210           CDS       T01015                                 

Gene name
OJ1343_D04.132, SODCC.2, SodCc2
Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    4344210 (OJ1343_D04.132)
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4344210 (OJ1343_D04.132)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 152 aa AA seqDB search
MVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtgcttgctagcagtgagggtgtcaagggcaccatctttttc
tcccaagagggagatggtccgacctctgtgacgggaagtgtctctgggctcaagccaggg
ctccatggattccatgtgcacgcgctcggtgacaccactaatggctgcatgtcaactgga
ccacacttcaatcctactgggaaggaacatggggcaccacaagatgagaaccgccatgcc
ggtgatcttggaaatataacagctggagcagatggtgttgctaatgtcaatgtctctgac
agccagatcccccttactggagcacactccatcattggccgagctgttgttgtccatgct
gatcctgatgatcttggcaagggtggacatgagcttagcaagaccactggaaatgctggg
ggccgagttgcttgcggaatcatcggactccagggttag

DBGET integrated database retrieval system