KEGG   Ottowia sp. oral taxon 894: ADJ79_07445Help
Entry
ADJ79_07445       CDS       T04031                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oto00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ADJ79_07445
Enzymes [BR:oto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ADJ79_07445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1703686..1705278
Genome map
AA seq 530 aa AA seqDB search
MTAAPMPTHRSELMQRLARPGRYDVAVIGGGATGLGVALDAAVRGLKVLLLEAHDFAKGT
SSRATKLVHGGVRYLAQGNVALVREALHERAHILAAAPHLAQPLAFVMPSYSWWETPWYG
MGLKVYDLLAGQASLGSTQWLGTIAVQNRLPGAQPQGLKGGVQYWDGQFDDARLALALAR
TAAAHGALLVNHCPVTQLRHAGGKVTGLRARDAETGQEYDIEAGCVINATGVWVDALRQQ
DAAATGRSAGALVAPSQGVHVVVDQDFLPGRRALLVPSTADGRVLFAVPWLGKLILGTTD
NPRHDLPLEPCPQEDEVDFILREAGRYLRRPPRRADVRSQWAGLRPLVKPQGQAATKSIS
REHTILIDASGLVTVTGGKWTTYRAMAQDVLARCADAGLVPQGKSRTAGLKLVGALPDGA
QAVPLNEAPGPHLYGGEADALTQLPGHERWVADGLSEAMVRFAARHEYARSVEDVLARRS
RLLFLDAAAAAAVAPAVANVLQEETGRDAGLESFLTLAAQFGSLGGAKRA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgcccctatgccgacccatcgatctgagctgatgcaacgtctggcccggccc
gggcggtatgacgtggcggtgattggcggcggcgccacggggctgggcgtggcactggat
gcggcagtgcgcggcctgaaagtgctgctgctggaagcgcatgactttgccaagggcact
tcatcacgcgccaccaagctggtgcatggcggggtgcgttatctggcgcagggcaatgtg
gcgctggtgcgcgaggcgctgcacgagcgcgcgcacatcctggcggcggcgccccatctg
gcgcagccgctggcgttcgtgatgccgtcttacagctggtgggaaacgccctggtacggc
atggggctgaaggtttatgacctgctggcgggccaggccagtttggggagtacgcagtgg
ctgggcacgattgccgtgcaaaaccgcctgccgggcgcgcagccgcagggcctgaagggc
ggcgtgcagtattgggatgggcagtttgacgacgcgcggctggcgctggcgctggcgcgc
acggcggcggcgcatggcgctttgctggtgaaccattgccccgtgacgcagttgcgccac
gcaggcggcaaggtgacggggctgcgggcaagggatgccgaaacagggcaggaatatgac
attgaggcgggctgcgtcatcaacgccacaggcgtgtgggtggacgccttgcgccagcaa
gacgccgcagccacagggcgcagcgctggcgcgctggttgcgcccagccagggcgtgcat
gtggtggtggatcaggactttctgcctggccgccgcgcgctgctggtgcccagcacggcg
gacgggcgcgttctgtttgccgtgccgtggctgggcaaactcattttgggcacgacggac
aacccgcgccatgatttgccgctggagccttgcccgcaagaagatgaagtggacttcatc
ttgcgcgaagcggggcgctacctgcgccgcccgccccggcgcgccgatgtgcgcagccag
tgggcggggctgcggccgctggtcaagccgcagggccaggctgcaaccaagtcaatcagc
cgcgagcacaccatcctgatcgacgcaagcgggctggtgaccgtgacgggcggcaaatgg
acgacttaccgtgccatggcccaggacgtgctggcccgctgcgccgacgcgggcctggtg
ccgcaaggtaaatcgcgcacggcaggcttgaagctggtgggcgccttgccggatggcgcg
caagccgtaccgttgaacgaggcgcccgggccgcatttgtatggcggcgaagcggatgcg
ctgacgcaactgccggggcatgaacgctgggtggcggacgggctgagcgaggccatggtg
cgctttgcggcgcggcatgaatacgcccgcagcgtggaagatgtgctggcgcgccgctcg
cgcctgctgtttctggacgctgcggctgcggctgccgtggcgcctgccgtggcgaatgtg
ctgcaagaagagacgggccgggatgccgggctggaaagctttctgaccttggctgctcaa
tttggcagtcttgggggcgcaaaaagagcttga

DBGET integrated database retrieval system