KEGG   Propionibacterium acnes C1: PAC1_03555Help
Entry
PAC1_03555        CDS       T02330                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pacc  Propionibacterium acnes C1
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAC1_03555
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAC1_03555
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PAC1_03555
Bacterial toxins [BR:pacc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PAC1_03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(751710..754025)
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALMPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKAPTATPFVEFAGSELSAR
DARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVNGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFFADLGKVERVIVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVIDAEGIVTTESGEPTDYT
VDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDGGQTWNLGKSP
NDERELFGKIVSSRNLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASVDGGET
WGEVTFVEQLTEIFSQPNAISVRDELGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQQDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgacctcactgggagcgccttg
atgccggcccgaaagggcatggacgtgcaacgaatcgacggcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgaagaccgcttgcttggccgtatagatctgaacggagaatct
cgcagtctcgacgccgaggatgcgctgggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggtatggtgccaggatctgggagcaaccaatattgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaagatgtggaactcagccctgtccttgcaagctatggcg
gccaaggcgccgacggcaacaccgttcgtcgagttcgctggttctgaactgtcggcccgc
gacgcacgccgtatcggagaactcgctcatggcgcgctccgagcaaggacccgtcttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcaacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
cggggtgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttctttgccgatcttggcaaggtggaaagggtgattgtcgggaaggacctcgaaggagca
cggctattcggggaagcacagacggcgtccatcttcagcagtgcgctaaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ctgggctcgaaaagttaccggatcccatcgctcatcagacttgattccggaagcttcatc
gccggggcagaccaacgtgtcagcattgccaacgacagccccaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggcccagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactcg
gggcgcgtgttctgcttgatcgaccagttcccgggtggcgtggggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgatcgcgatgcaaccgcc
tacgtcatcgatgcagaaggcatcgtaacaaccgagtcgggggaacccacggattacacc
gttgacgaaaccggaaacgtcttcgcagccggtgcccccgccggcaatatccacttggcc
accggagtggacccccacgagtccctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacatggtcacgacctatcaacctgaacccggctctcaag
cagccttggatgcggttcctcggtacgtcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtctactacaaccacgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgggggccagacatggaacctcggtaagtcaccg
aatgacgagcgcgaacttttcggaaagatcgtcagttctcgaaatctcaacgatgatcgc
ggctcgacccatgagtcagcgttagtagaaacccctgacggggtcgtgcactccttcatg
cgcaaccaacatccctccggacgggtggcgcacgcggccagcgtcgacggcggcgaaaca
tggggcgaggtgacgttcgtcgagcaactgaccgaaatcttctcccagcccaatgccatt
tctgtccgggatgagcttggaaccgaatcggtggtctttgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtgctgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgactcagcaagacgaacag
accctgctcgtattgtgggaacgggagtggcaaggcttgttcctgacagaggtcccgttg
tcatggcttaccacttcgcgcagcacgctggagtga

DBGET integrated database retrieval system