KEGG   Pseudomonas aeruginosa PAO1: PA3687Help
Entry
PA3687            CDS       T00035                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA3687 (ppc)
  Energy metabolism
   00680 Methane metabolism
    PA3687 (ppc)
Enzymes [BR:pae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PA3687 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PathoGenesis: 
UniProt: 
LinkDB All DBs
Position
complement(4127756..4130392)
Genome map
AA seq 878 aa AA seqDB search
MPEIDARLREDVHQLGELLGDTIREQYGPRFLDKIELIRKGAKAARRGSAEGAQQLTATL
DGLEEDELLPVARAFNQFLNLANIAEQYHRIRRRRPNEPEPFENLVLEELLGRLKDAGHA
PGQLARQLAGLEIELVLTAHPTEVARRTLIQKYDAITAQLAAKDHADLLPEERSRIQQRL
QRLVAEAWHTDEIRKVRPTPVDEAKWGFAVIEHSLWQALPNVLRHVDEVLLRSTGERLPL
TAAPLRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLYLRDIDRLAAELSMQQASPQ
LLARVGDSAEPYRALLKQLRERLRVTRNWTHQALAGEVPAAEGVLEHNRDLVEPLQLCHE
SLHACGMGVIADGALLDCLRRAATFGLFLVRLDVRQDSARHAAALSEITEYLELGSYDEW
DEKTRLEFLLEELNSRRPLLPAHYQPSADTAEVLATCRAIAAAPPASLGSYVISMAGQPS
DVLAVQLLLKESGVDWPMRVVPLFETLDDLDNAGPCMERLLTLPGYRSRLSGVQEVMIGY
SDSAKDAGTLTAAWAQYRAQEKLVEICRQHEVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRVTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLMPPPAPEPAWRAQMDRLA
KDALLAYRRVVRDDPQFVEYFRLATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT
QTRLMLPAWLGWETALLNAIERGEGALLGQMREQWPFFTTRIDMLEMVLAKADADIARLY
DERLVPLELRPLGRRLRDLLSQAVRVVLGLTGQSLLLAHASETRESISVRNSYLDPLHLL
QAELLARSRRCRGDACGGLEQALLVTVAGVAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaatcgatgcgcgcctgcgcgaggacgtccaccaactgggcgaattgctcggc
gacaccatccgcgagcagtacggcccgcggttcctcgacaagatcgagctgatccgcaag
ggcgccaaggctgcccgccgcggttccgcggagggcgcccagcagctcaccgccaccctc
gacgggctcgaggaagacgaactgctgccggtggcgcgggccttcaaccagttcctcaac
ctggccaatatcgccgagcaataccaccgtatccgccggcgccggccgaacgagccggaa
cccttcgagaacctggtgctggaagagctgctggggcgtctcaaggacgccgggcatgcc
cccgggcaactggctcgccagctcgccgggctggagatcgaactggtgctgaccgcccat
cccaccgaggtggcgcggcgcacgctgatccagaaatacgatgcgatcaccgcgcaactg
gcggccaaggaccatgccgacctgctgccggaggagcgcagtcgcatccagcagcgcctg
cagcggctggtggccgaggcctggcataccgacgagatccgcaaggtccggccgaccccg
gtggacgaggcgaaatggggcttcgcggtgatcgaacattctctctggcaggccttgccg
aacgtccttcggcacgtcgacgaggtactcctgcgcagcaccggcgaacgcctgccgttg
accgccgcgccgctgcgcttcgcgtcctggatggggggcgaccgcgacggcaatcccaac
gtcaccgccagcgtgacccgcgaggtcctgctgctggcgcgctggatggccgccgacctg
tacctgcgcgatatcgaccgactggccgccgagctgtccatgcagcaggcctcgccgcag
ctgctggcgcgggtcggcgatagcgccgagccctatcgcgccctgctcaagcaattgcgc
gagcgcctgcgcgtgacccgcaactggacccaccaggccctggccggcgaggtgccggcc
gcggagggcgtcctggagcacaaccgcgacctggtcgagccgctgcaactgtgccacgag
tcgctgcacgcctgcggcatgggcgtgatcgccgatggcgcgttgctcgactgcctgcgc
cgcgccgccaccttcggcctgttcctggtacgcctggacgtgcgccaggactcggcccgc
catgccgccgcgctgagcgagatcaccgagtacctggagctgggcagctacgacgagtgg
gacgagaagacccgcctggaattccttctcgaggaactgaacagccgccgccccctgctg
ccggcgcactaccagccttcggcggataccgccgaggtgctcgccacctgccgggcgatc
gccgccgcaccaccggcgtcgctggggtcctacgtgatctcgatggccggccagccgtcc
gacgtgctggcggtgcaactgctgctaaaggaaagcggcgtcgactggccgatgcgcgtg
gtgccgctgttcgagaccctcgacgacctggacaacgccggcccctgcatggagcgcctg
ctgacgctgccgggctaccgttcgcggctgtccggggtgcaggaagtgatgatcggctac
tccgattcggccaaggacgccggtaccctcacggcggcctgggcgcagtaccgggcgcag
gagaaactggtggagatctgccgccagcacgaggtcgagttgctgctcttccacggccgc
ggcggtaccgtcggtcgcggcggcgggccggcccacgcggcgatcctgtcgcagccgccg
ggttcggtggccgggcgcttccgggtcaccgaacagggcgagatgatccgcttcaagttc
ggtctgccggacatcgccgaacagaacctcaatctctacctcgccgcagtgctggaagcg
accctgatgccgccgccggctccggagccggcctggcgcgcgcagatggaccgcctggcg
aaggacgcgctgctggcctaccgcagggtggtgcgcgacgatccgcagttcgtcgagtat
ttccgcctggccacgcccgagcaggaactgggccgtctgccgctgggcagccgcccggcc
aagcgccgcgaaggcggggtggagagcctgcgggcgattccctggatcttcgcctggacc
cagacgcgcctgatgctgccggcatggcttggctgggagaccgccttgctgaacgccatc
gagcgtggcgagggcgcgctgctcgggcagatgcgcgagcaatggccgttcttcaccacc
cgcatcgacatgctggaaatggtcctggccaaggccgacgcggatatcgcgcggctctac
gacgaacgtctagtgccgctcgagctgcgtccgctggggcgtcgtttacgcgacctattg
tcgcaggcggtgcgcgtggtgctgggactgaccgggcagtcgctgctgctcgcccacgcc
agcgagacccgcgagtcgatcagcgtgcgcaacagctatctagacccgctgcacctgctc
caggctgagcttctggcccgttcgcggcgctgccggggcgacgcctgcggcggcctggag
caggcgctgctggtgacggtcgcgggggtcgccgccggactgcgcaacaccggatga

DBGET integrated database retrieval system