KEGG   Pseudomonas aeruginosa PAO1: PA4201Help
Entry
PA4201            CDS       T00035                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PA4201 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA4201 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PA4201 (ddlA)
Enzymes [BR:pae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PA4201 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:pae01011]
 Precursor biosynthesis
  Amino acid ligase
   PA4201 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PathoGenesis: 
UniProt: 
LinkDB All DBs
Position
complement(4700906..4701946)
Genome map
AA seq 346 aa AA seqDB search
MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLA
SKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAY
TGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEEVREQLGFPLVVKPNSQGSTV
GLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFD
YEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEV
NTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggacaagttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggac
gtctccatcgccagcggcgcgcaggtgatccaggctttgcgcagcgccggccaccaggtg
ctggcggtggataccgccagcggcctgctcggcgcggaggaagagcgccgcctgctggcg
agcaaggtcaaggaggtcccgccggactccgactcgctggcgatcatccgcagcggcaag
cagagcctgctgagcgccggcgaactggctggggtcgacgtgttcttcctcgccctgcac
ggcggcaccggcgaggacggcaccctgcaggcgctgctggatgccggtggtttcgcctat
accggcagcggccacctggccagcgccatggcgatggacaaggacgtggccaagcgcctg
ttcctcgccgccggggtggagaccgccagttggctgatggcgccggcctcggaagaggag
gtgcgcgagcaactgggcttccccctggtggtcaagccgaacagccagggctccaccgtg
gggctgtccatcgtgcattcccaggccgaattgcagccggccatcgagctggccgggcgc
tatggcgacgaggtgatgctggagcgcttcgtcgccggccgcgaggtcaccgtcggggtg
ctcgacgaccaggcgctgccggtgggcgagattctcctcggcggccaggaggtcttcgac
tacgagcacaagtaccaggccggcgcggtgcgcgaggtgtttcccgccgacctgccgccg
gcgatcgccgccgaggcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagc
ggctacagccgcaccgacttccgcctcgacgaacagggccggctctggtgcctggaggtc
aataccctgccgggcatgaccgccaccagcctgctgccgcaggccgcggcggcggccggg
atcggtttcgccgaactctgcgagcggatctgccggctcggcatcgagcgctgcaagggc
gcgcgcaaggcgcgttcctga

DBGET integrated database retrieval system