KEGG   Pseudomonas aeruginosa PAO1: PA4265Help
Entry
PA4265            CDS       T00035                                 

Gene name
tufA
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
Translation factors [BR:pae03012]
 Eukaryotic Type
  Elongation factors
   PA4265 (tufA)
 Prokaryotic Type
   PA4265 (tufA)
Mitochondrial biogenesis [BR:pae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PA4265 (tufA)
Exosome [BR:pae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PA4265 (tufA)
  Exosomal proteins of breast cancer cells
   PA4265 (tufA)
  Exosomal proteins of colorectal cancer cells
   PA4265 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PathoGenesis: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(4767811..4769004)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALMALE
GKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGII
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccatcggtcac
gttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctccgatacctgg
ggtggttccgctcgtgctttcgatcagatcgacaacgcgccggaagaaaaggcccgcggt
atcaccatcaacacctcgcacgttgaatacgattccgctgttcgtcactacgcccacgtt
gactgccccggtcacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgccaggtaggcgttccctacatcgtcgtgttcctgaacaaggccgacatg
gtcgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatggcgctggaa
ggcaaggatgacaacggcatcggcgtaagcgccgtgcagaagctggtagagaccctggac
tcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgcggcatcatc
aaggtccaggaagaagtggaaatcgtcggcatcaaggcgaccaccaagactacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgttggtatc
ctgctgcgtggcaccaagcgtgaagacgtagagcgtggccaggtactggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccaccgat
gtgaccggtaactgcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcgatc
cgcgaaggcggccgtaccgttggcgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system