KEGG   Pseudomonas aeruginosa c7447m: M802_1066Help
Entry
M802_1066         CDS       T03098                                 

Definition
(GenBank) hypothetical protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
paec  Pseudomonas aeruginosa c7447m
Brite
Enzymes [BR:paec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     M802_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 Helicase_C_3
Motif
Other DBs
NCBI-ProteinID: AGV65222
LinkDB All DBs
Position
complement(1122268..1122909)
Genome map
AA seq 213 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYAIHPINISQGDQFQADFLKVSPNNKIPAIVDRQP
ADGGAPLSLFESGAILLYLAEKTGRFLAKDLRARQETLQWLFWQMGGLGPMAGQNHHFNR
FAPEKIPYAIDRYVKETARLYGVLEQRLADRAFVAGDDYSIADMAIYPWIVPHQWQEQDL
ADFPHLQRWFESIRQRPATQRAYALVERINPPK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggaccaccccgaacggccacaagattactcttttcctggaa
gaaaccggcctgccctacgccatccatccgatcaacatcagccagggcgaccagttccag
gcggatttcctgaaggtgtcgccgaacaacaagattcccgccatcgtcgatcgccaaccg
gccgacggcggcgctcccctgtcgctgttcgagtccggcgccatcctgctctatctcgcg
gaaaagaccggacgcttcctcgccaaggacctgcgcgcgcgccaggaaaccctgcagtgg
ctgttctggcagatgggcgggctggggccgatggccgggcagaaccaccatttcaaccgc
ttcgccccggagaagattccctacgccatcgaccggtacgtcaaggaaaccgcgcgcctg
tacggcgttctcgagcagcgcctggcggaccgcgccttcgtcgccggcgacgactacagc
atcgccgacatggccatctatccgtggatcgtcccgcaccagtggcaggagcaggatctt
gccgacttcccgcacctgcagcgctggttcgagagcattcgccagcgtccggcgacgcaa
cgcgcctatgctttggtggagcgcatcaatccgccgaagtag

DBGET integrated database retrieval system