KEGG   Pseudomonas aeruginosa c7447m: M802_2202Help
Entry
M802_2202         CDS       T03098                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:paec00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    M802_2202 (ligD)
Enzymes [BR:paec01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     M802_2202 (ligD)
DNA repair and recombination proteins [BR:paec03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     M802_2202 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2352287..2354809
Genome map
AA seq 840 aa AA seqDB search
MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLK
SWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPR
EGLEKGHLSFALDGEKLSGRWHLIRTNLRGKQPQWFLVKAKDGEARSLDRFDVLKERPDS
VLSERTLLPRHGETATPAARPARRGKSGGKTPMPEWIAPELASLVEQPPRGEWAYELKLD
GYRLMSRIEDGHVRLLTRNGHDWTERLPHLEKALAGLGLQRSWLDGELVVLDEEGRPDFQ
ALQNAFEEGRGENILYVLFDLPYHEGEDLRDVALEERRARLEALLEGRDEDPLRFSATLA
EDPRDLLASACKLGLEGVIGKRLGSAYRSRRSNDWIKLKCQLRQEFVIVGYTEPKGSRRH
IGALLLGLYSPDEERRLRYAGKVGSGFTAASLKKVRERLEPLAVRSSPLAKVPPARETGS
VQWVRPQQLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPLRGARKAGAG
ASRAATAGVRISHPQRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVRGPDGIGG
ELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTWNASLANL
ERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLVPLERRHG
WDEVKDFAQAISQHLARLMPERFSAVSGPRNRVGKIFVDYLRNSRGASTVAAYSVRAREG
LPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRISAAMRRQLGRG
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagcaagccgctcgccgagtacgcccgcaagcgcgatttccgccagaccccg
gagcccagcggccgcaagcctcgcaaggacagcaccgggctgctccgctattgcgtccag
aagcacgacgccagccgcctgcactacgacttccgcctggagctggatggcaccctgaag
agctgggcggtgcccaaggggccgtgcctcgacccggcggtgaagcggctcgcggtgcag
gttgaggaccatccgctggactatgccgatttcgaaggcagcatcccccaggggcactac
ggcgccggcgatgtcatcgtctgggaccgaggcgcctggacgcctctggacgatccgcgc
gagggcctggaaaagggccatctcagcttcgccctggatggcgagaaactctccgggcgt
tggcacctgatccgcaccaacctgcgcggcaagcagccccagtggttcctggtcaaggcc
aaggacggcgaggcgcgcagcctggatcgcttcgacgtgctgaaggagcgtcccgacagc
gtgctcagcgagcgtacgctgctgccccgccatggcgaaaccgccacgcccgcggccagg
ccggcgcgacgcggcaagagcggggggaagacgccgatgcccgaatggatcgcccccgag
ctggccagcctggtcgagcagcctccgcgaggggagtgggcctacgaactcaagctggac
ggctatcggctgatgagccgcatcgaagacggccacgtgcgcctgctgacccgcaacggc
catgactggaccgaacgcctgccgcacctggagaaggccttggccgggctcggtctgcag
cgcagttggctggacggcgaactggtcgtcctcgacgaggagggtcgaccggacttccag
gccctgcagaacgccttcgaggaaggtcgcggcgagaacatcctgtacgtcctcttcgac
ctgccgtaccacgaaggcgaggatctgcgcgatgtcgccctggaggagcgccgcgcgcgc
ctggaggcgctgctggaagggcgagacgaagacccgctgcggttctccgcgacgctcgcg
gaagacccccgcgacctgctggccagcgcctgcaagctcggtctcgaaggcgtgatcggc
aagcgtctgggcagcgcctaccgttcgcgccgcagcaacgactggatcaagctgaagtgc
cagttgcgccaggagttcgtgatcgtcggctataccgagccgaagggctctcgccggcat
atcggcgccttgctgctcggcctctacagccctgacgaggagcgccggctgcgctatgcc
ggcaaggtcggcagcggcttcaccgcggccagcctgaagaaggtccgtgagcgcctggaa
cccctcgcggtccgttccagcccattggcgaaggtgccgccggcgcgcgagaccgggtcg
gtgcagtgggtgcgcccgcaacagctgtgcgaggtttcctatgcgcagatgacccgtggc
gggatcatccgccaggcagtgttccacggcttgcgcgaagacaagccggcgcgtgaggtg
accggcgagcgtcccgccggcccgccgccgctgcgcggcgcgcgcaaggccggcgccggt
gcgtcgcgggcggccaccgccggcgtgcgcatcagccatccgcagcggctgatcgacccg
tcgatccaggccagcaagctggaactcgccgagttccatgcgcgctacgccgacctgctc
ctgcgcgacctgcgcgagcgcccggtgtcgctggtgcgcggccccgacggaatcggcggc
gaactgttcttccagaagcacgcggcgcgcctgaagatccccggcatcgtccagctcgac
ccggcgctcgatcccggtcatccgccgctgttgcagatccgcagcgccgaggcgctggtc
ggcgcggtgcagatgggcagcatcgaattccatacctggaacgccagcctggccaacctg
gagcggcccgaccgtttcgtcctcgacctcgacccggacccggcgctgccgtggaagcgc
atgctcgaagcgacccagctgagcctgacgttgctcgacgagctgggcctgcgcgccttc
ctcaagaccagcggcggcaagggcatgcacctgctggtgccgctggagcgccggcatggc
tgggacgaggtcaaggatttcgcccaggccatctcccagcacttggcgcgcctgatgccg
gagcgtttctcggcggtttccgggccgcgcaaccgggtcggcaagatcttcgtcgactac
ctgcgcaacagccgcggcgccagcaccgtggccgcctactcggtgcgcgcccgcgaaggg
ttgccggtgtcggtaccggtgttccgcgaggaactcgactcgctgcagggcgccaaccaa
tggaacctgcgcagtctgccgcagcgcctcgacgaactcgccggcgacgatccctgggcc
gactacgccggcacccgccagcgcatcagcgcggccatgcggcgccagctcgggcgcggc
tga

DBGET integrated database retrieval system