KEGG   Pseudomonas aeruginosa YL84: AI22_00095Help
Entry
AI22_00095        CDS       T03035                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paeg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AI22_00095
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AI22_00095
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AI22_00095
Enzymes [BR:paeg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AI22_00095
Peptidoglycan biosynthesis and degradation proteins [BR:paeg01011]
 Precursor biosynthesis
  Amino acid ligase
   AI22_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(21883..22908)
Genome map
AA seq 341 aa AA seqDB search
MKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERHLLASKVKE
VPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAYTGSGH
LASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVREQLGFPLVVKPNSQGSTVGLSIV
HSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFDYEHKY
QAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEVNTLPG
MTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggacgtctccatcgccagc
ggcgcgcaggtgatccaggcgttgcgcagcgccggccaccaggtgctggcggtggatacc
gccagcggcctgctcggcgcggaggaagagcgccacctgctggcgagcaaggtcaaggag
gtcccgccggactccgactcgctggcgatcatccgcagcggcaagcagagcctgctgagc
gccggcgaactggctggggtcgacgtgttcttcctcgccctgcacggcggcaccggcgag
gacggcaccctgcaggcgctgctggatgccggtggtttcgcctataccggcagcggccac
ctggccagcgccatggcgatggacaaggacgtggccaagcgcctgttcctcgccgccggg
gtggagaccgccagttggctgatggcgccggcctcggaagaggcggtgcgcgagcaactg
ggcttccccctggtggtcaagccgaacagccagggctccaccgtggggctgtccatcgtg
cattcccaggccgaattgcagccggccatcgagctggccgggcgctatggcgacgaggtg
atgctggagcgcttcgtcgccggccgcgaggtcaccgtcggggtgctcgacgaccaggcg
ctgccggtgggcgagattctcctcggcggccaggaggtcttcgactacgagcacaagtac
caggccggcgcggtgcgcgaggtgtttcccgccgacctgccgccggcgatcgccgccgag
gcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagcggctacagccgcacc
gacttccgcctcgacgaacagggccggctctggtgcctggaggtcaataccctgccgggc
atgaccgccaccagcctgctgccgcaggccgcggcggcggccgggatcggtttcgccgaa
ctctgcgagcggatctgccggctcggcatcgagcgctgcaagggcgcgcgcaaggcgcgt
tcctga

DBGET integrated database retrieval system