KEGG   Pseudomonas aeruginosa MTB-1: U769_08380Help
Entry
U769_08380        CDS       T02951                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    U769_08380
   00790 Folate biosynthesis
    U769_08380
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U769_08380
Enzymes [BR:paem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     U769_08380
Exosome [BR:paem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U769_08380
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:paem00537]
 Enzymes
  U769_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1798808..1800238)
Genome map
AA seq 476 aa AA seqDB search
MTPGYPLALSLAVSMAVLGSALPAQARQDDPSLFNRQARGELSEYGGARRVEQDLTQALK
QSLSKKKAKNVILLIGDGMGDSEITVARNYARGAGGYFKGIDALPLTGQYTHYSLHKDSG
LPDYVTDSAASATAWTTGVKSYNGAIGVDIHEQPHRNLLELAKLNGKATGNVSTAELQDA
TPAALLAHVTARKCYGPEATSKQCPSNALENGGAGSITEQWLKTRPDVVLGGGAATFAET
AKAGRYAGKTLRAQAEARGYRIVENLDELKAVRRANQKQPLIGLFAPGNMPVRWLGPTAT
YHGNLNQPAVSCEANPKRTADIPTLAQMTSKAIELLKDNPNGFFLQVEGASIDKQDHAAN
PCGQIGETVDLDEAVQKALAFAKADGETLVIVTADHAHSSQIIPPETAAPGLTQLLTTKD
GAPLAISYGNSEEGSQEHTGTQLRIAAYGPQAANVTGLTDQTDLFFTIRRALNLRD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggttatcccctcgccctctctcttgccgtctccatggccgtgctcggcagc
gccttgccggcccaggcgcgccaggacgatccgtcgctgttcaaccgccaggcccgtggc
gaactcagcgaatacggcggcgcacggcgcgtcgagcaggacctgacccaggccctgaag
cagtcgctgtcgaagaagaaggcgaagaacgtgatcctgctgatcggcgacggcatgggc
gactccgagatcaccgtggcgcgcaactacgcgcgcggcgcgggcggctacttcaagggt
atcgatgcgctgccgctgaccggccagtacacccactactccctgcacaaggacagcggc
ctgccggactacgtgaccgattccgccgcctccgccaccgcctggaccaccggggtcaag
tcgtacaacggcgcaatcggcgtggatatccacgaacagccacaccgcaacctgctggag
ctggccaagctcaacggcaaggccaccggcaacgtctccaccgccgagctgcaggacgcc
accccggccgccctgctcgcccacgtcaccgctcgcaagtgctacggccccgaagccacc
agcaagcagtgcccgagcaatgccctggagaacggcggcgccggctcgatcaccgagcaa
tggctgaagacccgccctgacgtggtcctcggcggcggcgccgcgaccttcgcggaaacc
gccaaggctggccgctatgccggcaagaccctccgcgcccaggccgaagcccgcggctac
cggatcgtcgagaacctcgacgagctgaaagccgtgcgccgcgccaaccagaagcagccg
ctgatcggcctgttcgcgccgggcaacatgccggtgcgctggctcggtccgaccgccacc
taccacggcaacctgaaccagccggcggtgagctgcgaagcgaacccgaagcgcaccgcc
gacatcccgaccctggcgcaaatgaccagcaaggccatcgagctgctgaaggacaatccg
aacggcttcttcctgcaggtcgagggcgcgtccatcgacaagcaggaccacgccgcgaat
ccgtgcggccagatcggcgagaccgtcgacctcgacgaagccgtgcagaaggccctggcc
tttgccaaggccgatggcgagaccctggtgatcgtcaccgccgaccacgcccactccagc
cagatcatcccgccggaaaccgccgcgccggggctgacccaactgctcacgaccaaggac
ggcgcgccgctggcgatcagctacggcaactccgaggaaggctcccaggagcacaccggc
acccagttgcgcatcgccgcctacggcccgcaggccgccaatgtcaccggcctgaccgac
cagaccgacctgttcttcaccatccgtcgcgcactgaacctgcgcgactga

DBGET integrated database retrieval system