KEGG   Paenibacillus sp. FSL P4-0081: P40081_03495Help
Entry
P40081_03495      CDS       T03332                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paen  Paenibacillus sp. FSL P4-0081
Brite
Enzymes [BR:paen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     P40081_03495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AIQ27368
LinkDB All DBs
Position
complement(748316..749509)
Genome map
AA seq 397 aa AA seqDB search
MQYVSGAPLPVHILGEIAFWKKQEKEHAEVLIQLTPNLEEPYVKLLQEWTVVFLATEQAA
CQLLGSQQAPAFGGPGSLAAETELLLHTACSQSSEFIRQLKAMGEASQAMSASPLAGVVV
KHFICESEYFLAVLTALSAPEYGAGAGMMRQNPIEQDEPAAVPAVSLSEDSPQETAAWTA
PLWEARELGPVPIGGHTLPPLPYAYNALEPYIDEKTMIIHHDKHHQSYVDGLNKAEIKLA
EARKSNDYDLVKHWERELAFNGAGHYLHTIFWNVMSPQGGGRPSGALLDAIIRSFGSYDA
FKAQFTEAANKVEGGGWAILVWSPRSRRLEILTAEKHQNLSQWDVVPLLALDVWEHAYYL
KHQNNRADYIQDWWKVVNWPYVAERYSAARKLVWQPF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtatccggtgcgccgctgccagtgcacattctaggggaaattgccttctgg
aaaaaacaggagaaagaacacgctgaggttcttatccagcttactccaaacctcgaggag
ccttatgtcaagctgctccaggaatggacggttgtcttcctggctacggagcaggcggcg
tgtcaactgctcggaagccaacaggctccggccttcggcggtccgggaagccttgccgcc
gaaacagagctgctgcttcatacagcctgcagccaatccagtgaattcatccgccagctg
aaggctatgggggaggctagccaggccatgagcgcctcccctctggccggggtcgtagtg
aagcattttatctgcgaatcggagtatttccttgccgtgcttacagctctcagcgccccg
gaatatggagccggtgccggcatgatgcggcagaacccaatagagcaggatgaaccggct
gctgtgcctgcggtgtccctaagtgaagactctccccaggaaacggcggcttggacggct
cctctgtgggaagcccgtgaattggggccggtcccgatcggcgggcacacactgcccccg
ctcccttatgcttataatgcgctggagccctacattgacgagaagacgatgattattcat
cacgacaagcaccaccagagctatgtagacggactcaataaagcagagattaaattggcg
gaagcccggaagagcaatgattatgatctcgttaaacactgggaacgggagcttgccttt
aacggggcgggccattatctgcacacgatcttctggaacgtcatgtccccgcagggcggc
ggccggccatccggagcactgctggatgccattatacggagcttcggaagctacgatgcc
ttcaaggcccagttcactgaagcggccaataaagtggagggcggcggatgggccatcctg
gtctggagcccgcgcagccgcaggctggagattctgactgctgagaagcatcagaatctg
tcccagtgggatgttgtcccgctgctggcgctggatgtatgggagcatgcctattatctc
aagcatcagaataaccgcgcagattatatccaggactggtggaaagtcgtgaattggcct
tacgtagccgagcggtacagtgccgcccgcaagctggtctggcagcctttttga

DBGET integrated database retrieval system