KEGG   Paenibacillus sp. FSL P4-0081: P40081_35745Help
Entry
P40081_35745      CDS       T03332                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P40081_35745
Enzymes [BR:paen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     P40081_35745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
8050546..8052030
Genome map
AA seq 494 aa AA seqDB search
MKRNHTMMQFFEWHVAADGEHWKRLAQMAPDLKAAGIDSVWVPPVTKAVSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTKQELVDAIAECLKNGIAVYVDLVMNHKAGADETEVFEVIEV
DPNDRNKDISQPFEIEGWTKFDFPGRGDEYSSFKWNHTHFNGTDFDAKASRNGVFRIDGT
NKGWNQNVDDEFGNYDYLMFANIDYSNEDVKNEMLNWGKWLVDTLQCSGYRLDAIKHINH
EFVKEFAAEMKKKRGEDFYIVGEFWNSNLEACREFLNTVDYQIDLFDVSLHYKLYSAALA
GRDFDLTHIFDDTLVQTHPANAVTFVDNHDSQPHEALESWVGDWFKQSAYALILLRRDGY
PVVFYGDYYGIGGPAPVEGKKDAIDPLLCARYNKAYGDQDDYFDHPNTIGWVRRGVPEIE
GSGCAVVISNGDNGEKRMFAGEARGGEVWEDLTGNRQETVTIGEDGWAVFPVNGGSVSVW
ALPDPEPEDDCVKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaaccatactatgatgcaattttttgaatggcatgttgccgcagacggagaa
cactggaaacgccttgcccaaatggcccctgacctgaaggcggcgggaattgattccgta
tgggtccctcccgtaaccaaggcggtctctccggaagataccggttatggagtctatgat
ctatacgatctgggcgaatttgatcaaaagggtgccgtacgcacgaaatacggaaccaag
caggaactggtcgacgcgattgccgaatgtctgaagaacggcatcgcggtctacgtggat
ctggtcatgaaccataaggccggggcagatgagacagaggtgtttgaggtcattgaggtc
gatcctaacgaccgcaataaggatatctcccagccgtttgagattgaaggctggaccaag
tttgattttccggggcgcggggatgagtactccagcttcaaatggaaccacacccacttc
aacggcaccgatttcgatgccaaggcaagccggaacggcgtattccggatcgatggtacg
aataaaggctggaatcagaatgtggatgatgaattcggcaattacgactatctgatgttc
gccaatattgattacagtaatgaagacgtgaagaacgaaatgctgaactggggcaaatgg
ctggtcgacaccctgcagtgcagcggctaccgcctggatgccattaagcatatcaaccat
gagttcgttaaagaatttgcggcggagatgaaaaagaaacgcggcgaagacttctacatt
gtcggcgaattctggaactccaatctggaggcctgccgcgaattcctgaacaccgttgac
tatcagatcgatctgttcgatgtatcgctgcattacaagctctactcggctgcgctggcg
ggcagggacttcgatctgacgcatatctttgacgatacgctggtccagacgcatccggcc
aatgccgtcaccttcgtcgacaaccatgactcccagccgcatgaggcgctggaatcatgg
gtcggcgactggttcaagcagagtgcctatgccctgattctactgcggagggacggatac
cccgttgtcttctacggcgattattacggtatcggcggcccggcgccggtggagggcaag
aaggacgccatcgatcctctgctctgtgcccgttacaacaaggcctacggcgaccaggat
gattacttcgaccatcccaacaccatcggctgggtgcggcgcggtgttccggagatcgaa
ggctccggctgcgccgtagtgatctcgaacggggacaacggagagaagcggatgttcgcc
ggcgaagcgcgcggcggggaagtatgggaggatctgaccggcaaccgccaggagactgtc
accatcggagaagacggctgggcagtattcccggtgaatggcggaagcgtctcggtctgg
gccctgcccgatccggagccggaggacgattgcgtgaaagagtga

DBGET integrated database retrieval system