KEGG   Pseudomonas aeruginosa PAO581: M801_2570Help
Entry
M801_2570         CDS       T03171                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00020  Citrate cycle (TCA cycle)
paeo00480  Glutathione metabolism
paeo01100  Metabolic pathways
paeo01110  Biosynthesis of secondary metabolites
paeo01120  Microbial metabolism in diverse environments
paeo01130  Biosynthesis of antibiotics
paeo01200  Carbon metabolism
paeo01210  2-Oxocarboxylic acid metabolism
paeo01230  Biosynthesis of amino acids
Module
paeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paeo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M801_2570
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M801_2570
Enzymes [BR:paeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     M801_2570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AGV60869
LinkDB All DBs
Position
2746755..2748980
Genome map
AA seq 741 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEAD
QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEE
KEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLSLQEGEVLDSMFMSCGKLRDFFEKTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLADGSVLMQHKVETGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSH
FYLAMYWAQALAAQNEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNP
ELTSKVMRPSATFNAAIDSLA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcgctcgccacc
tactcgctcctccccatcgtcaaggcctttgccgcttccgccggcatcgacgtcgagacc
agcgacatctctcttgcaggacgcatcctggccaacttcgccgaccgcctcgaagccgac
cagcgtatcgaagacgacctcgcccgcctggcggtcctggccacctcgcccgacgccaat
atcatcaagctgcccaacatcagcgcctcggtgccccagctgaaaggcgcgatcgccgag
ctgcagggcctgggctacaaggttcccgacttcccggaagacccgcagaccgacgaagag
aaagaggttcgcgcacgctacgcgaagatcctcggcagcgccgtgaacccggtcctgcgc
gaaggcaattccgaccgtcgcgcgcctgccgcagtgaaggcctacgcccgcaagcacccg
cactccatgggcaagtggagcatggcctcgcgctcccacgccgactacatgcgcggcggc
gacttcttctccagcgaacagtccatcaccatggccaaggccggtgacgtgcgcatcgaa
ttcgtcggcaaggacggcaaggtcgaggtcaagaagcaactgagcctgcaggaaggcgaa
gtgctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atttcccacccgatcgtcttcggacatgcggtgagcgtctactacaaggacgtcttcgac
aagtggggccaactcttcgaagagctcggcgtgaacccgaacaacggtatctccagcgtc
tacgacaagatcaagtcgctgcccgcctcccagcaggaagagatcctccacgacatccac
gaggtgtacagccaccgcccggaaatggcgatggtcgactccgtgaaaggcatcaccaac
ctgcacattccgagcgacgtcatcgtcgacgcctcgatgccggcgatgatccgcaactcc
ggccagatgtggggcaaggacggcaagcagaaagacaccaaggcggtaatgccggaaagc
acctacgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgac
ccgaccaccatgggcagcgtgccgaacgtcggcctgatggcgcagaaggccgaggaatac
ggctcccacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtggtcctggcc
gacggcagcgtgctgatgcagcacaaggtggagaccggcgacatctggcgcgcctgccag
accaaggacgcgccgatccgcgactgggtcaagctggccgtcacccgcgcacgccagtcc
gataccccggcgatcttctggctggacccggagcgcgcccacgaccgcgaactgcgcaag
aaggtcgagctgtacctcaaggaccacgacctgaccggtctcgacatcagcatcatgggc
tacaacgaggccattcgcgtcagcatggaacgcctgatccgcggcaaggacaccatctcg
gtgaccggcaacgtcctgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acctcggccaagatgctctccatcgttccgctgatggcgggcggcggcatgtacgaaacc
ggcgccggcggctcggcacccaagcacgtccagcaactggtggaagagaactacctgcgc
tgggactccctgggcgagttcctggccctggccgtgtccctggaggaaaccgggatcaag
accggcaacgccaaggccaagctgctcggcaaggcgctggacgaagccaccggcaagctg
ctggacaacaacaagtcgccgtcgcgcaaggtcggcgacatcgacaaccgcggcagccac
ttctacctggcgatgtactgggcccaggccctggccgcccagaacgaagacgctgagctg
aaagcgcacttcgcaccgctggccaaggccctgaccgagcaggaagcgaccatcgtcgcc
gaactcaatgcggtccagggcaagccggccgagatcggcggctactatcgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgcggcgatcgacagcctg
gcctga

DBGET integrated database retrieval system