KEGG   Pseudomonas aeruginosa PA1: PA1S_17735Help
Entry
PA1S_17735        CDS       T02928                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:paep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PA1S_17735
Enzymes [BR:paep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PA1S_17735
Transporters [BR:paep02000]
 Other Transporters
  Pores ion channels [TC:1]
   PA1S_17735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AHA21142
LinkDB All DBs
Position
complement(3818123..3818725)
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYRSGNCYKIKLAMSLLGIDYQWVPVDILKGETQTPEFLAKNPNGKIPVLELED
GSCLWESNAILNFLADGSALLPSEPRLRTQVLQWQFFEQYSHEPYVAVARFIKLYLGLPE
ARRAEFEEKKIGGYKALDVMEKQLSRTPFLVGEQFSIADITLYAYTHVAHEGGFDLTAYP
AIRAWIKRVGEVPGYVGMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtctacggtgattaccgttcgggcaactgctacaagatcaagctggccatg
tcgctgctcggcatcgactaccagtgggtaccggtggacattctcaagggcgagacccag
accccggagttcctggcgaagaaccccaacggcaagataccggtgctggagctggaggac
ggcagttgcctgtgggagtccaacgccatcctcaacttcctcgccgacggcagcgccctg
ttgcccagcgaaccgcgcctgcgcacccaggtgctgcaatggcaattcttcgagcaatac
agccatgagccctatgtggccgtggcgcgcttcatcaagctctacctcggcctcccggaa
gcccgccgcgccgagttcgaagagaagaagatcggcggctacaaggccctcgacgtcatg
gagaaacagctgtcgcgcacgccattcctggtcggcgaacagttctccatcgccgatatt
accctctacgcctacacccatgtcgcccatgaaggcggcttcgacctgacggcctacccg
gcgatccgcgcgtggatcaagcgagtgggggaggtgccggggtatgtggggatgctggat
tga

DBGET integrated database retrieval system